SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023013 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000023013
Domain Number 1 Region: 42-194
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.85e-34
Family Mannose 6-phosphate receptor domain 0.00000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023013   Gene: ENSGALG00000014256   Transcript: ENSGALT00000023056
Sequence length 291
Comment pep:known_by_projection chromosome:Galgal4:1:75660141:75665386:-1 gene:ENSGALG00000014256 transcript:ENSGALT00000023056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNPMCSLWYISRMSSHCHTSAVLVVFMALAAGVGAEPLSEKSCDVVGDESTESQMEKAL
LKKLEPLSQIRFNTTVEIGTTENYAYHFRVCREVNSSLHDFAGLVQMDRQSGKTTVIGRI
NETQVFNGSDWIMLIYKGGDSYGRHCSGEKRRAVIMISCKRGITASSFSIISEEREKEQD
CFYLFEMDSSVACPAEDSHLSTGSILLITFSALVTVYIVGGFLYQRLIVGAKGMEQFPHF
AFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGDESEERDDHLLPM
Download sequence
Identical sequences ENSGALP00000023013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]