SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023048 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000023048
Domain Number 1 Region: 5-170
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.83e-46
Family G proteins 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023048   Gene: ENSGALG00000014277   Transcript: ENSGALT00000023091
Sequence length 191
Comment pep:known_by_projection chromosome:Galgal4:4:68611531:68612106:-1 gene:ENSGALG00000014277 transcript:ENSGALT00000023091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDSIKCVLVGDSAVGKTSLLVRFISDTFPDNYRPTVYENTGVDVFMDGVQISLGLWDTS
GSDAFKGIRPLSYQQADVVLMCYSVANHNSFLNLRSKWIGEIRNHLPRIPVLVVATQTDQ
RDTGPYRSSCISSMDGKRLAQDVRAKGYLECSALSNRGVQQVFEYAVRTAVNQAKRQNRR
KLFSINECKIF
Download sequence
Identical sequences E1BVI6
9031.ENSGALP00000023048 XP_004936170.1.86415 XP_004936171.1.86415 XP_015140937.1.86415 XP_015140938.1.86415 XP_015140939.1.86415 XP_015156872.1.86415 XP_015156873.1.86415 ENSGALP00000023048 ENSGALP00000023048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]