SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023088 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000023088
Domain Number 1 Region: 122-262
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-38
Family C-type lectin domain 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000023088
Domain Number - Region: 94-111
Classification Level Classification E-value
Superfamily Hypothetical protein PH1602 0.00981
Family Hypothetical protein PH1602 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023088   Gene: ENSGALG00000024426   Transcript: ENSGALT00000023131
Sequence length 274
Comment pep:known scaffold:Galgal4:AADN03010677.1:384:3066:-1 gene:ENSGALG00000024426 transcript:ENSGALT00000023131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSVQIPVLKHKVSTPAEGERLNHFSEHKAAPEPPAHQRRRIPTSSDPQLPEEDVHISELE
SNTSMPPVGEGDQRETFSEHQAAPEPPEESGEGPQWGSWCHGAGRRRSRVQLIAACAALG
ALILVLVVISTVCRQVPVPPFPDFAHVCPNAWVGFQGKCYYLSKEEYDWNSSREHCNAHG
ASLATIGSAEEMDFMMRFQGPANCWIGLHREEEDAQWMWSDGTAFTNWFELRGGGRCAYL
NGDRISSSLCHLHKHWVCSRADHYVLWKQKVHPQ
Download sequence
Identical sequences ENSGALP00000023088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]