SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023098 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000023098
Domain Number 1 Region: 93-245
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-35
Family C-type lectin domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023098   Gene: ENSGALG00000014317   Transcript: ENSGALT00000023141
Sequence length 257
Comment pep:known scaffold:Galgal4:JH376323.1:20234:23108:-1 gene:ENSGALG00000014317 transcript:ENSGALT00000023141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFFSFTPRFLLEVFAKKSDPLGPVYAQRDPSLLLSPHTMGAVPHLGAAKEEKERLSPS
PPREATVQPGDEEVRAQRGSRCSELRQNRRRVLCVALSAVPCILVSALVAVIVLQRPSCP
PRPPFSHVCPNTSIGFQGKCYYFSDTESDWNSSKEHCHHLGASLATIETEEEMEFMLRYR
GPANCWIGLHRAEGDEHWTWANGSAFTNWSVFELRGRGQCAYLNGDRISSALCHNEKFWV
CSRADSYVRWRKKALLV
Download sequence
Identical sequences ENSGALP00000023098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]