SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023393 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000023393
Domain Number 1 Region: 586-811
Classification Level Classification E-value
Superfamily vWA-like 4.45e-61
Family Integrin A (or I) domain 0.00025
Further Details:      
 
Domain Number 2 Region: 19-212
Classification Level Classification E-value
Superfamily vWA-like 9.88e-56
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 3 Region: 257-380
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.06e-18
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 461-581
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 339-458
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000785
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 6 Region: 217-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000283
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 7 Region: 890-933
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000209
Family Chicken cartilage matrix protein 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023393   Gene: ENSGALG00000014523   Transcript: ENSGALT00000023439
Sequence length 935
Comment pep:known_by_projection chromosome:Galgal4:2:127183885:127242408:1 gene:ENSGALG00000014523 transcript:ENSGALT00000023439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKDLPVGHFTRRRDVSSQSLLENTCNNKRLDLVFIIDSSRSVRPYDFEKVKEFILTILQ
FLDVSPDATRVGLIQYGSTVKHEFSLKTFRRKQEIERAVRRMMHLATGTMTGLAIQYAVN
IAFSESEGARPLNQNVPRIIMIVTDGRPQDPVGEIAAKARNSGILIFAIGVGRVDMNTLK
SIGSEPHEEHIFLVANFSQIETLTSVFQTKLCVPHMCSIAEHRCDHFCINTPGSYVCRCK
QGYILNADQRTCSTQDLCAVEKHNCEQICVNTPGSYVCQCYEGYELDADGKNCVVVDYCA
VDNQGCQHECVNTEDSYYCRCHPGFILNADKRTCRRPDYCALQDHGCEQECVNTDDSYFC
RCQEGFRLNPDKKTCKSDVNICELGQHDCEHECVNLESFMCKCHLGCALGGDHNTCRRVD
HCAENDHGCEQLCLNTDDSYVCQCSEGFVINEDLRTCSRVDYCVLSDHGCEHLCINGDKS
YTCQCFEGYRLRNDGKTCKHKDICSSVDHGCEHVCVNADESYICQCYEGFALRQDGKTCR
SKDICKSVNHGCEHACVNAGDTFVCKCQEGFLLREDGKTCRSKDVCKSVAHGCEHICVNN
DDSYICKCQEGYVLKEDQKTCRRCTEGPVDLVFVIDGSKSLGEDNFEIVKQFVSGILDTL
EISPKAARVGLLQYSSEVRTEFTLRRFSTAKDMKKAVSQMKYMGRGSMTGLALKQMFERS
FTETEGARPLSANIPRISIVFTDGRAQDEVSEWAARAKRSGIIIYAIGIGKAIEEELLEI
ASEPSYKHLFYAEDFTAMEDISEELKVQICEALRNSAHQQHLSSGRLHRTNPQPSGPEST
TVEITDVLACPSLAIQHKYLFEDSQSHSTRTTGHSCGCSQNKLDCFPAKTSKDQCKCENL
VTFQNYATNEVRRLTQRLLEEMTKRMEDLENRLKY
Download sequence
Identical sequences ENSGALP00000023393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]