SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023499 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000023499
Domain Number 1 Region: 427-679
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.74e-70
Family Eukaryotic proteases 0.000000953
Further Details:      
 
Domain Number 2 Region: 17-129
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-32
Family Spermadhesin, CUB domain 0.0000044
Further Details:      
 
Domain Number 3 Region: 173-288
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-27
Family Spermadhesin, CUB domain 0.0000888
Further Details:      
 
Domain Number 4 Region: 358-432
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000129
Family Complement control module/SCR domain 0.00061
Further Details:      
 
Domain Number 5 Region: 295-361
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000264
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 6 Region: 126-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023499   Gene: ENSGALG00000014603   Transcript: ENSGALT00000023545
Sequence length 690
Comment pep:known chromosome:Galgal4:1:76859359:76868459:1 gene:ENSGALG00000014603 transcript:ENSGALT00000023545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWYLIFFCHPVWANAASMYGEILSPNYPQAYPNDLQESWEIQVPPGYGIRLYFTHLDLEP
SQNCEYDSVKILSGGRVERLLCGSKKTHAPGSPIVEEFYMPYNTLTMTFQSDFSNEERFT
GFAAYYVAVDLDECTDFVDELCSHYCNNYIGGYFCTCPPDYFLYEDKKTCGVNCSGNVFT
EPSGEIASPNYPNQYPENSQCKYQVVLKSGYFVALTIHSEDFDVEPADSTGNCRDSLTLV
SGKRRYGPYCGSKFPGPPEIKTRSNILDIIFQTNHMVQRKGWKIRYYAEPITCLPSVTPN
SVLDPKKDRYIFTDSVKVTCVEGYEIVRQYDSIRTFHSICQNNGEWSNSDFSCVPVNCGD
PSPIDNGNYVYISELHEPLYQATVQYFCKAPYYTLQNKEEAVYQCSASGQWISEEMGTEL
PTCVAVCGIPSNPIRETGKIFGGTLAAKGNFPWQVFFHSPRGAGVLISERWVMTAAHVLD
GYDLPTMYAGTINIGETALRNGKQLVPEASFIHPGWKRLPTNTHRTDFDNDIALLKLKEP
VEMGPNISPLCLPGKSPEYELQIGTLGYIAGWGKREKGRLPNYLWKAQIPVVDMDKCRSV
KPEGSADSSAYRFTDNMICAGGGKDSCNGDSGGAYSVQDPFNSSQSYVAGLVSWGPRCGT
FGLYTKVVRYVDWITETMNKHDTKKPSIIS
Download sequence
Identical sequences F1N803
ENSGALP00000023499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]