SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023620 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000023620
Domain Number 1 Region: 2373-2445
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.84e-19
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 2 Region: 573-697
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.28e-19
Family Growth factor receptor domain 0.0061
Further Details:      
 
Domain Number 3 Region: 1724-1795
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.19e-19
Family TB module/8-cys domain 0.00042
Further Details:      
 
Domain Number 4 Region: 989-1058
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-18
Family TB module/8-cys domain 0.00071
Further Details:      
 
Domain Number 5 Region: 2088-2158
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.75e-18
Family TB module/8-cys domain 0.0000915
Further Details:      
 
Domain Number 6 Region: 486-616
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.07e-17
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 1885-2011
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.14e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 8 Region: 349-415
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.53e-17
Family TB module/8-cys domain 0.0019
Further Details:      
 
Domain Number 9 Region: 2166-2300
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.08e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 10 Region: 2488-2616
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.02e-17
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 11 Region: 1355-1490
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.41e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 12 Region: 1065-1202
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 13 Region: 692-765
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.92e-16
Family TB module/8-cys domain 0.00084
Further Details:      
 
Domain Number 14 Region: 203-288
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.19e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 15 Region: 751-893
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000124
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 16 Region: 884-968
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000129
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 17 Region: 1564-1637
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000157
Family TB module/8-cys domain 0.0000456
Further Details:      
 
Domain Number 18 Region: 1193-1331
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 19 Region: 2258-2375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000314
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 20 Region: 2613-2729
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000146
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 21 Region: 1643-1698
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000297
Family EGF-type module 0.00063
Further Details:      
 
Domain Number 22 Region: 245-363
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000612
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 23 Region: 2448-2492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000105
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 24 Region: 2049-2102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000264
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 25 Region: 1802-1856
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000812
Family EGF-type module 0.0024
Further Details:      
 
Domain Number 26 Region: 1521-1568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000011
Family EGF-type module 0.00059
Further Details:      
 
Domain Number 27 Region: 1484-1532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000444
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 28 Region: 2003-2046
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 29 Region: 1845-1883
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000723
Family EGF-type module 0.01
Further Details:      
 
Domain Number 30 Region: 1318-1355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000292
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000023620
Domain Number - Region: 174-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00485
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 2820-2864
Classification Level Classification E-value
Superfamily Cadherin-like 0.0479
Family Cadherin 0.015
Further Details:      
 
Domain Number - Region: 141-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0782
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023620   Gene: ENSGALG00000014686   Transcript: ENSGALT00000023666
Sequence length 2903
Comment pep:known chromosome:Galgal4:Z:56586636:56749770:-1 gene:ENSGALG00000014686 transcript:ENSGALT00000023666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRQRWLCLQPCFLWLSCLALCAHGAAGQQKPPPRVRPAGGAGGIYPAAAVAHREEGAGS
AAAAAGRVRRRGQQEALRGPNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCGDGFCSR
PNMCTCASGQISPTCGPKSTQQCSIRCMNGGTCADDRCQCQKGYIGVYCGQPVCEKGCQN
GGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRA
WGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGVCQGGNCINTVGSYECKCPAG
HRQNEATQKCDDIDECIIIPGVCEGGECSNTVGSYFCLCPRGYVSSTDGSRCIDQRASTC
FSNLVNGRCAQELPGRFTKRQCCCESGRCWAIGSVPEMCPVRGSDEHRRLCVDGVPAGGG
SRSGGGTGGNGFLPGGNGNGYSPGGAGFIPVPGSNGFSPGVGGAGVGTGGQTPAGNGPII
TGLTILNQTIDICKHHPNLCLNGRCIPTISSYRCECNMGYKQDANGDCIDVDECTSNPCS
NGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAG
FELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTS
GICMNGHCINTEGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACIRPFPGAVTK
SECCCANPDYGFGEPCHPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICSNGICE
NLRGSYRCNCNSGYEPEPSGRNCVDIDECSVNGLLCDNGLCRNTPGSYSCTCPKGYVFST
ETDTCEDTNECESSPCVNGACRNNLGSFSCECSPGSKLDSTGLICIDSLKGTCWLNIQDS
RCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVKGVTCEDVNECDVFPGV
CPNGRCVNSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIQSVPGKFRMDAC
CCAVGAAWGSDCEECPKPGTKEYEALCPRGPGFSNRGDILTGRPFYKDINECKVFPGMCM
NGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGTCVNTPGSFECECFDG
YESGFMMMKNCMDIDECERNPLLCRGGMCVNTEGSFQCDCPVGHELSPSREECIDVNECS
LSDNLCRNGNCVNMVGTYQCSCNSGYQATADRQGCVDIDECMIMNGGCDTHCTNSEGSYE
CSCSDGYALMPDVRTCADIDECENNPDICDGGQCSNIPGEYRCLCYDGFMASMDMKTCID
VNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCV
NVPGSFKCTCREGWFGNGIKCIDLDECSNGTHQCSVNAQCVNTPGSYRCACAEGFTGDGF
TCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDIDECSFQNICVFGT
CNNLPGMFHCICDDGYELDRSGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLN
PTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVN
STEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYYLSE
ETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYN
GTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTAEFKNICGNIPGFTFDIHTGK
AVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNA
DCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDMQGSYQCICHNGFKA
SQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSFFGQVC
RNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPP
GYEVKSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQSFCF
TNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGTIPGI
DDTREDVNECLESPGICSNGHCINTDGSFRCECPMGYNLDFTGVHCIDTDECSIGNPCGN
GTCTNVIGSFECNCHEGFEPGPMMNCEDINECAQNPLLCAFRCINTYGFYECTCPVGYEL
RDDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMTRRPDGEGCTDENECRTK
PGICENGRCMNVIGSYRCECNEGFLSSPSGIECLDNRQGFCFAEVLQTMCQMASSSRNLV
TKSECCCDGGRGWGNQCELCPLPGTTQYKKLCPHGPGYTTDGRDIDECKVMPNLCRHGQC
INTMGSFRCFCKVGYTTDISSTSCVDLDECSQSPKPCNFICKNSEGSYQCSCPRGYILQE
DGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGSK
GICQNTPGSFTCECQRGFSLDSTGLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYIQ
HYQWNQCVDENECSNPNTCGSASCYNTLGSYKCACPSGFSYDQFSSACHDVNECSSAKNP
CNYGCSNTEGGYLCGCPPGYYRVGQGHCVSGMGFNKGQYVPVDEDADEENALSPEACYEC
KINGYPKKDNRRKRSLNETIEQVSLESLDMDSPLKMRVNISRLDNKEHILELMPAIEPLT
NHVRYIISHGNDDGVFRIHQRDGLSYLHTAKKKSVPGTYTLEITSIPLYKKKELKKLEDS
NEDSYLLGELGEALRMRLWLELY
Download sequence
Identical sequences ENSGALP00000023620 XP_424715.3.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]