SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023648 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000023648
Domain Number - Region: 445-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000195
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 879-908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0105
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 398-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.022
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 288-428
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0306
Family Growth factor receptor domain 0.004
Further Details:      
 
Domain Number - Region: 793-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0773
Family Laminin-type module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023648   Gene: ENSGALG00000014699   Transcript: ENSGALT00000023694
Sequence length 1207
Comment pep:known_by_projection chromosome:Galgal4:Z:56172597:56274452:1 gene:ENSGALG00000014699 transcript:ENSGALT00000023694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPARAEGPGADRAVPSAGRDGRRERGRETEGGAAPRRTHRPSPGAAAAATRRRSGGTQ
RPLGRGGRPRTGYLFEKMFLHLNSFFGFPVILLYHWLGTTLSLNLEDPNVCSHWESYSVT
VQESYPHPFDQIYYTSCTDILNWFKCTRHRISYRTAYRHGEKTMYRRKSQCCPGFYESRE
MCVPHCADKCVHGRCIAPNTCQCEPGWGGPNCSSACDSDHWGPHCSSRCQCKNGALCNPI
TGACHCASGFKGWRCEERCDQGTYGNDCHQKCQCQNGATCDHVTGECRCPPGYTGAFCED
LCPPGKHGPQCEERCPCQNGGICHHVTGECACPPGWMGMVCGQPCPEGRYGNNCSQECQC
HNGGICDSATGQCHCSPGYTGERCQDECPVGTYGVRCAETCQCMNGGKCYHISGACLCEP
GYTGEHCETRLCPEGVYGLKCDKKCPCHLHNTWSCHPMSGECSCKPGWSGLYCNETCSPG
FYGKSCQQICSCQNGADCDSVTGKCICASGFKGADCGTPCLPGTYGVNCSSVCNCKNEAI
CSSVDGSCTCKAGWHGVDCSINCPSGTWGLGCNLTCQCLNGGACNALDGTCTCAPGWRGE
KCELPCQDGTYGMDCAERCDCSHADGCHPTTGYCRCLPGWSGIHCDSVCAEGQWGPNCSL
SCYCKNGASCSPDDGICECAPGYRGTTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITG
LCDCLPGFTGALCNEVCPSGRFGKNCIGICTCTNNGTCNPIDRSCQCYPGWIGSDCSQPC
PPSHWGPNCIHTCNCHNGAYCSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCALICQCRN
GADCDHISGQCTCRTGFMGKHCEQKCPQGTYGYGCRQICDCLNNSTCDHITGTCYCSPGW
KGARCDQAGVIIVGNLNSLSRTSTAIPADSYQIGAIAGIIILVLIVLFLLVLFIIYRHKQ
KGKETNMPAVTYTPAMRVINADYTISETIPHSNGGNANSHYFSNPSYHTLTQCTTPPHVN
NMDRLTLAKAKNNQLFVNLKNVEPGKRGTVMDYTGTLPADWKHGGYLNELGAFGLDRGYL
GKSLKDLVKNSEYNLSNCSLSSSENPYATIKDPPALVPKSSECGYVEMKSPVRRDSPYAE
IASSASANKNVYEVEPTVSVVQGAFNSSGRFSQDPYDLPKNSHIPCHYDLLPVRDSPTSS
TKEVGSE
Download sequence
Identical sequences ENSGALP00000023648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]