SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023740 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000023740
Domain Number 1 Region: 249-469
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.09e-59
Family Reprolysin-like 0.00045
Further Details:      
 
Domain Number 2 Region: 558-614
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000012
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 3 Region: 905-961
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000392
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 845-901
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000288
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 1019-1070
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000301
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Domain Number 6 Region: 964-1019
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000023740
Domain Number - Region: 705-745
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.0501
Family Diacylglycerol kinase-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023740   Gene: ENSGALG00000014751   Transcript: ENSGALT00000023786
Sequence length 1119
Comment pep:known_by_projection chromosome:Galgal4:Z:20223745:20378797:-1 gene:ENSGALG00000014751 transcript:ENSGALT00000023786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIFWKTWTWILSLVMVSSEFHSDSRLSYSSQEEFLSYLEHYQLTIPIRVDQNGAFLSFT
VKNAKPSRRRRSTDPYDQELSASKLFFKLSAYGKHFHLNLTLNTDLVSRHFTVEYWGKDG
PQWKHDFLDHCHYTGYLQDQHTTTKVAVSNCNGLHGVIATEDEEYFIEPLKNVTANSSNF
TYENGHPHVIYKKSTMRQHLLYDHSRCGVSEDLTRSSKPWWMSDGSAFPTSLPVNDTLSS
HSRQKRSVSLERFVETLVVADKMMVGYHGRKDIEHYILSVMNIVAKLYRDSSLGNVVNII
VTRLIVLTEDQPNLEINHHADKSLDSFCKWQKSILSHQSDGNTIPENGIAHHDNAVLITR
YDICTYKNKPCGTLGLASVAGMCEPERSCSINEDIGLGSAFTIAHEIGHNFGMNHDGIGN
SCGTKGHEAAKLMAAHITANTNPFSWSACSRDYITSFLDSGRGTCLDNEPPKRDFLYPAV
APGQVYDADEQCRFQYGATSRQCKYGEVCRELWCLSKSNRCVTNSIPAAEGTLCQTGSIE
KGWCYQGECVPFGTWPQSIDGDWGPWSIWGECSRTCGGGVSSSIRHCDSPAPSGGGKYCL
GERKRYRSCNTDPCPAGARDFREKQCADFDNMPFRGKYYNWKPYTGGGVKPCALNCLAEG
YNFYTERAPAVIDGTQCNADSLDICINGECKHVGCDNILGSDAKEDRCRVCGGDGSTCEA
IEGFFNDSLPRGGYMEVIQIPRGSVHIEIREVAVSKNYIALKSEEDDYYINGAWTIDWPR
KFDVAGTAFHYKRPTDEPESLEALGPTSENLIVMILLQEQNLGIRYKFNVPISRTGSGDN
EVGFAWNHLPWSECSATCAGGVQKQEVVCKRLDDNSVVQNNYCDPDSKPPENQRACNTEP
CPPEWFIGDWSECSKTCDGGVRSRTVLCIRKIGPSEEETLDSTNCLTHRPIEKEPCNNQS
CPPQWVALDWSECTPKCGPGFKHRIVLCKSSDLLKTFPAAQCQEESKPPVRIRCSLGRCP
PPRWVTGDWGQCSAQCGLGQQMRTVQCLSYTGQASSECSETHRPPSMQQCESKCDSTPIS
NTEECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTCQGH
Download sequence
Identical sequences ENSGALP00000023740 XP_424749.4.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]