SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023901 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000023901
Domain Number 1 Region: 557-622
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000472
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 486-532
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000123
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 3 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 613-670
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000445
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 5 Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000523
Family LDL receptor-like module 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000023901
Domain Number - Region: 438-476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0619
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023901   Gene: ENSGALG00000014835   Transcript: ENSGALT00000023947
Sequence length 834
Comment pep:known_by_projection chromosome:Galgal4:Z:12795475:12817485:1 gene:ENSGALG00000014835 transcript:ENSGALT00000023947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMLGIFLLLEVSGFFPIFSSPSRPVNCHWNSFGPWSECDGCTHKQVRRRTVAVYGQYGG
NPCSGDAFETRPCTPTRGCPTEDGCGDRFRCSSGQCISRSLVCNGDQDCEEDGTDEDQCE
EKLTVCDTDKTPPNSELTGQGFDAVTGETRGRVIHTKNFGGQCRKVFSGDGREYYRLSES
VLAYTFQVKIQNDFSYEFFNSSWSYMKHTEKKKKSNSGHSYSEKKNEQQSRKSRQLMVVE
NTVEVAQFINNNPEFLTLAEPFWKELANLPVFYDYSAYRRFIENFGTHFLHSGSLGGQYK
VIFYMDTDKMKAEDMSITDMYQCTTSGWNFFIVKKKKTKCSKLDELLQTSSGSSGSKIRG
DPYIEGGSPSAVAGLSYLDLDDPAGNNQRYSTWARSVTDYPRVIKQKLTPLYELVKEVPC
SSVKKHYLKQSIEEYMAENDPCKCQPCQNGGEAAVEGTQCTCYCKPYTFGAACELGTLVQ
DQPGVVDGHWSCWSSWSSCSGERKTRSRTCNNPSPSGGGKDCIGEQHESRPCEDEELQHF
RFIEPHCFDTSITPTEFCSPPPVLANGFVRNAENSYPVGKTIVYACRHGYALIGNPVAKC
GSNLEWQGGDRYCQETSCLLPLLEGGLQGEPWKPSYEIGERITLSCPHGMHLEGADSILC
EPSLKWTPDMKTIQCKKAVPSVKPEVTEPKCQPWEKVQQSQCVCKLPYECGPSLDICATD
PRTERSVHLTVCKMYALECMGRKYSLTNTANCKARQAAERSCGSCCSWEKCEARSNSCVC
DEDAPCEEGGIRVCAAVSDFSAHQTMTECEVGRLQCRGQTVTIVSIRPCDAQTK
Download sequence
Identical sequences E1C6U2
ENSGALP00000023901 XP_424774.2.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]