SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023996 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000023996
Domain Number 1 Region: 336-497
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.49e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000586
Further Details:      
 
Domain Number 2 Region: 121-231
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-26
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 3 Region: 235-333
Classification Level Classification E-value
Superfamily LCCL domain 1.7e-25
Family LCCL domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023996   Gene: ENSGALG00000014907   Transcript: ENSGALT00000024042
Sequence length 798
Comment pep:known_by_projection chromosome:Galgal4:3:62847768:62894456:-1 gene:ENSGALG00000014907 transcript:ENSGALT00000024042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAALPVLPLPLPTPGPGGRQRCTRRAERGPFASAATPAGRGMPLGGRPPGLAGGPGPG
PPLRGREEEKGAGEKRGSCVSPGAGAMSPAGGARAAPSLLFSLLLAASAPLWLRAEKMGD
GCGHVVMYQDSGTLASKNYPGTYPNYTLCEKKIQVPQGKRLILKIGDLDIESQKCESSYL
TILSSSTLHGPYCGNMMPVPKEIILDSNEATIHFESGSHVSGRGFLLSYASSDHPDLITC
LERANHYTKTEYSRYCPAGCRDIAGDISGNIEEGYRDTSLLCKSAIHAGVIADELGGQIS
VTQQKGISRYEGVVANGISSHDGSLSDKRFMFTSNGCNRSLSLEEGFLSKSQITASSYWE
ETNEFGQLFQWTPDKAWLQVLGLAWASNHSSSREWLEIDLGEKKRITGIKTTGSGSTLQN
FNFYVKTFILNYRNNNSKWRTYRGILSNEEKVFQGNSDSGDIVRNNFIPPIVARYVRIIP
QSWNQRIALKLELIGCRIMQVNSSFTHSMWQKTSQSTETSLGKEDRTVTEPIPSEETNLG
LKLTAIIVPVLIVLCLFLFSGICICAALRKQEAKGLSYGLSNAQKSGCWKQIKQPFTRHQ
STEFTISYNNEKETPQKLDLVTSDMADYQQPLMIGTGTVTRKGSTFRPMDTEEEGRRGSA
EFENHYHCPHRANRHEYALPLTSQEPEYATPIIERHVTRENNFPSENGYNVPVISSQKHS
LSAGSFSGSCKTDTRNGDYQTPQSVINYDKPKANGILTSVSYSTEYQKPQANALGSEGYS
TPRDCLNPISQTAMTALL
Download sequence
Identical sequences E1C5Q1
ENSGALP00000023996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]