SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000024465 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000024465
Domain Number 1 Region: 65-296
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.37e-60
Family Eukaryotic proteases 0.0000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000024465   Gene: ENSGALG00000015192   Transcript: ENSGALT00000024511
Sequence length 329
Comment pep:known_by_projection chromosome:Galgal4:28:3113569:3115852:-1 gene:ENSGALG00000015192 transcript:ENSGALT00000024511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSAVLGLLLLLALPNPGLGEHCSGAGVDDGASVAPQGAAERGGSHPRSSAVAVGWAAP
PLAAQSHLRIIGGHEAKPHSRPYMVSVQSKGVHTCGGALLNPRWVLTAAHCIPESADVSR
MMVVVGLHRLQERRNAQSFAIRSACPHPGYDSQTMEDDLLLLQLEGKVKRSKRQRPIALL
RREPAVGTVCSLAGWGGRRGLKAALQELEVAVLDTRMCNNSRFWNGDLTPSMICFEGRGR
GEAPTSGDSGSPLVCGRPAAVAGVMSFSSRNPTDPLKPPVATSAVKHHAWIRRTLRRGCA
AQTEQPQLFTQGSPQLSDKAAGTPTSSQP
Download sequence
Identical sequences F1NTI2
XP_003642924.3.86415 ENSGALP00000024465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]