SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000024492 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000024492
Domain Number 1 Region: 2028-2185
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000107
Further Details:      
 
Domain Number 2 Region: 1873-2027
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.09e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000003
Further Details:      
 
Domain Number 3 Region: 351-533
Classification Level Classification E-value
Superfamily Cupredoxins 4.74e-50
Family Multidomain cupredoxins 0.0000166
Further Details:      
 
Domain Number 4 Region: 1548-1724
Classification Level Classification E-value
Superfamily Cupredoxins 8.2e-45
Family Multidomain cupredoxins 0.0000314
Further Details:      
 
Domain Number 5 Region: 31-205
Classification Level Classification E-value
Superfamily Cupredoxins 9.4e-42
Family Multidomain cupredoxins 0.00000222
Further Details:      
 
Domain Number 6 Region: 1735-1872
Classification Level Classification E-value
Superfamily Cupredoxins 6.53e-33
Family Multidomain cupredoxins 0.00000972
Further Details:      
 
Domain Number 7 Region: 208-330
Classification Level Classification E-value
Superfamily Cupredoxins 9.02e-31
Family Multidomain cupredoxins 0.0000156
Further Details:      
 
Domain Number 8 Region: 542-661
Classification Level Classification E-value
Superfamily Cupredoxins 5.53e-30
Family Multidomain cupredoxins 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000024492   Gene: ENSGALG00000015207   Transcript: ENSGALT00000024538
Sequence length 2201
Comment pep:known_by_projection chromosome:Galgal4:1:83010008:83046065:1 gene:ENSGALG00000015207 transcript:ENSGALT00000024538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALHCVHLFLLLLLSSWWPDSEKHVVGAVKVREHYIAAQFTVWTYKPESEEKSRLTHLDP
VFKKISYREYEVDFKKEKPADKSTGLLGPTLRAEVGDTLVVHFKNMADKPISIHPQGLVY
NKKAEGSLYADRTSHVEKQDDAVLPGQVYTYVWDITEEVGPREADLPCLTYAYYSHENMV
MDFNSGLIGALLICKKGSLNEDGSQKLFDKEYILMFGVFDENKSWQRSASLKYTINGYAD
GTLPDLEACMYDNISWHLIGMSSKPEIFSVHINGQVMEERHHRISTVNLVGGASTTVNMT
VSEEGRWLISSLVQKHLKAKMHGYLTVRDCGDREVKKSRLSLKERRMIKNWEYFIAAEEV
VWDYAPTIPDSLDKRYKAQHLDNYSNLIGKKYKKAIFRQYTDGSFTKRLENPRPKETGIL
GPIIRAQINDKVKIVFKNKASRPYSMYFHGVTLSKNAEGADYPQDPTGNATQSKGIQPGK
TYTYEWQIAKTDQPTAQDAQCITRLYHSAVDIERDIASGLVGPLLICKSEALSQKGVQKK
ADGEQHAMFAVFDENKSWYIEDNIKDYCSNPASVRRDDPKFYNSNIMHTINGYVSDRNEI
LGFCQDNVVQWHFSSVGTQDEVVSIRLSGHAFLYRGKYEDVLNLFPMSGESVTVEMDNIG
KRQDWLVRLQCLFDSSSKLCFKPQSVRIYRSRKPFQENLELLSVAPDMYGALLAAQVFST
YIITCANTEALLVVLCVFASYSLIPNSDSQLLHLNQDSQVTLVTVEQSGYTLPQVIGHLT
AVKSATLNQHLGLVNLLLLEIGETMQVALNTELSFCILSLLLVPKASIQQAKNLMPYYTS
FSTDPSFKWKTSSTNLKVLVIPPKPSHLDAEAGSLINYHPLCIQKLLKYHICQRFVYIVS
QIALFRIFMCVAINIIPKTDKSPALNIGSSISFFFLFHIDLFHGVLIIFHCSVAHRKLNG
CCRKKKQQFSLTVYVIGSIHSHNTASSWGATEMSYGMRLRFRDVRCDYEDDNLFDVVDFT
NTKTDKKALSTSVEEDVEEEAEDDDSEYQDLLASFYSIRSLRNTGETEETQNLTAMAWGQ
DGDIDTASSKLAIDSDLTVTNGSKLTEFLETRIAPPLQVETETFQSNYTSVTAEEYLLLA
SASDGKPDLVFENRSQSDYAVDHSNMSGGEHLLSNGEAHVKDAEEPLTDRKDSNFFTEEH
QEESAGKRNNSINSKRKKRSPLAVQKMKALLDHHTENTSSTATVGAGQHPSDYDDDLEEE
ETKEGNAMHAGNLTLELEATVEENESNTSRLSQLELSKDKQSDSFSLDQTLGNIRPNSSP
ALVKNFLEASLPRAVKYSSKMTDEEWNLVSAKGIQRLEANLDKSVSGKLNYGGRNGTIFL
NKKHKKKDGEFSHLMGEKHKGNHMRSPLKRKYIWNLCQDPKEKKEYPKTTQFLNPRSKKP
QKFAKPTEEFGRTLFPGGANHESLPCCNTTESPSYTQQLKPSIVIGLPHENGNYEYTSGE
YYTEDTSGDEYEYYYVSFDDPYMTDPKLNVNEQRNPDNIAEHYLRSRGNERRYYIAAKEV
CWNYAGLKKSTMMYDKICKDGSTKKVIFQRYTDSTFTTVQDEGEYEEHLGILGPVIRAEV
NDVILVHFKNLASRPYSLHAHGLFYEKSSEGSIYDDESSDWFKEDDKVQPNSSYIYVWYA
NRRSGPLQPGAACRSWVYYSDVNLEKDTHSGLIGPILICEKGTFSASDNNRTNTRDFFLL
FMVFDEEKSWYFDKRSRKPCTEKTQEMQQCHKFYAINGITNNLQGLRMYEGELVRWHLLN
MGVPKDIHVVHFHGQTFIEQLEAKYQLGTYTLLPGSFQTVEMKPQRPGWWLLDTEVGEYQ
QAGMQASYLVLEKGCRIPMGMASGVILDSQINASHHIDYWEPKLARLNNSGTYNAWSTTM
TEDLPWIQVDFQRQVLLTGIQTQGAKHFLKSFYVQKFFIVYSTDKRKWNTFRGDSSPAEK
IFEGNSDAYGIKENIIDPPIIARYIRVYPKQAYNEPTLRMELLGCEVDACSLPLGMENGE
IKNTQITASSVKTSWFSTWEPSLARINQKGKINAWRAKSNNNQQWLQIDLLTIKKITAIA
TQGVKSVTTENFVKTYVILYSNQGSEWKSYTEDSSSVAKVFSGNEDSRGHVKHFFNPPIL
SRFIRIVPKTWYNGIALRVELFGCDFGGDLTAKRTEKSGSS
Download sequence
Identical sequences ENSGALP00000024492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]