SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000024578 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000024578
Domain Number 1 Region: 222-382
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.92e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000364
Further Details:      
 
Domain Number 2 Region: 9-118
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-30
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 3 Region: 121-219
Classification Level Classification E-value
Superfamily LCCL domain 1.31e-24
Family LCCL domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000024578   Gene: ENSGALG00000015258   Transcript: ENSGALT00000024624
Sequence length 693
Comment pep:known_by_projection chromosome:Galgal4:1:83935565:83975399:1 gene:ENSGALG00000015258 transcript:ENSGALT00000024624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGCGHTVLGPESGTLASINYPQTSPNSTVCEWEIRVKPGQRIQLKFGDLDIDDSDSCHSS
YLRVHNGIGPTRTEIGKYCGFGFQMDGLITSRSNEVTVQFMSGVHTSGRGFLAAYSTTDK
SDLITCLDNASHFSEPEFNKYCPAGCVIPFADISGTIPHGYRDSSSLCMAGVHAGVVSNT
LGGQINVVISKGIPYYEGSLANNVTSKVGPLSPSLFTFKTSGCYGTLGMESGVISDSQIT
ASSILEWPDQTGRVNTWKPENARLKRHGPPWAALDSDERQWLQIDLNKEKRITGIITTGS
TLAEYYYYVSAYRVLYSDDAQKWTVYREPGIDKDKVFQGNTELYQEVRNNFIPPIIARFV
RINPLKWHQKIAMKVELLGCQFSIVRAPKISMLPPPPPPQDNTNKVDDIGEDFIHSVKTS
LQTDKTTFTPEIKNTTVTPSVTKDVALAAVLVPVLVMVFTTLILILVCAWHWRNRKKKTE
GTYDLPYWDRAGWWKGMKQFLPTKSAEHEETPVRYSSSEIGRLRPREVPAMLQTESAEYA
QPLVGGIVGTLHQRSTFKPEEGKEASYADLDPYNSPIQEVYHAYAEPLPITGPEYATPIV
MDMSSHPSTPLGVPSISTFKAAGNQAPSLVGTYNKLLSRTDSASSAQALYDTPKGQLGPG
TADELVYQVPQSTAHSISSKDEPNMRDLFKISF
Download sequence
Identical sequences ENSGALP00000024578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]