SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000024779 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000024779
Domain Number 1 Region: 576-823
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.95e-80
Family Eukaryotic proteases 0.0000498
Further Details:      
 
Domain Number 2 Region: 80-212
Classification Level Classification E-value
Superfamily SEA domain 6.15e-23
Family SEA domain 0.0084
Further Details:      
 
Domain Number 3 Region: 252-347
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000864
Family Spermadhesin, CUB domain 0.0078
Further Details:      
 
Domain Number 4 Region: 465-511
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 351-457
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000471
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 6 Region: 540-579
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 7 Region: 499-536
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000357
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000024779   Gene: ENSGALG00000015389   Transcript: ENSGALT00000024825
Sequence length 827
Comment pep:known_by_projection chromosome:Galgal4:1:87984701:88010363:1 gene:ENSGALG00000015389 transcript:ENSGALT00000024825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRKRLPEPMILHPERKVANISVQMVSAEDKLVKRILARKKHGKLKKKEKMLWNFQNQII
LFTLILFVLGVVTWTLLWLFIVQAENKDALYFVGLFRVANIEFLPEYRQKESKEFLSVAQ
NVQRVMNLVYTTSSFSKFYKQSTVTEVSNNNNGGLLIHFWIVFVVPQAKGQALCEDCVAA
ILKDSIQTSIVNRTSVGTLQDLAVDMDSIVLSAGLRSDYWSTTGTGSNCVYDLHADRLHE
HFPLDIHTTSGGTICYLKLIALVGHLIRLSVVSLQIEADNCITDSLTIYDSLMPIKHKTL
YRACEPADSLVSLVSTNNLMLVIFKAAHIKEQKGFHGYFEVITQERCGKAIVTKERIGYE
GRITSPYYPSYYPPKCLCVWNFQTPQKNLGIALKFHNYTISEKNIKGCERGWWKINEHMY
CGFYVDHQTVFHVASSAVNIELQCSSKVSEKPLLVEYGSYNISQPCPPGYFKCSTGLCIQ
QMQRCDGVNNCFDESDELFCVVPEWNCNSSFAIQDNLLVCNGVNDCENGEDEQNCTESIP
CTNHTFKCRNNVCIKKQNAKCDGTVDCTDGSDESSCRCGSSKNGNLISRIVGGTNSKEGE
WPWQVSLHFVGAAYCGASVISKEWLVSAAHCFQGSKLADPRAWRAHLGMRIQGRAKFVSA
VRRIIVHEYYNSRNYDYDIALLQLSKPWPDTMSHVIQPICVPPFSHKVRSGDKCWITGWG
QKQEADDEGAAILQKAEVEIIDQTLCHSTYGIITARMFCAGLMSGRRDGCKGDSGGPLSC
QSNEDGKWFLTGIVSWGYGCGRPNFPGVYTRVSNLAPWIYKHVPSVM
Download sequence
Identical sequences 9031.ENSGALP00000024779 ENSGALP00000024779 ENSGALP00000024779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]