SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000024780 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000024780
Domain Number 1 Region: 359-618
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.19e-93
Family Eukaryotic proteases 0.00000745
Further Details:      
 
Domain Number 2 Region: 107-218
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-21
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 3-99
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000366
Family Spermadhesin, CUB domain 0.0087
Further Details:      
 
Domain Number 4 Region: 332-370
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000224
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000024780
Domain Number - Region: 288-325
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000641
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000024780   Gene: ENSGALG00000019221   Transcript: ENSGALT00000024826
Sequence length 618
Comment pep:novel chromosome:Galgal4:1:88016675:88034394:1 gene:ENSGALG00000019221 transcript:ENSGALT00000024826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPKKSFYQWRLRVPSNCVVKLVVTSLHVVASEGCASHRLSAYDFLLPLQNKIITRWCGS
GAWTPPVIRLISSTNVMLLTFSLDHRGERSILKAHFQAIPKISKRMCGGHYISWNGSLSS
PYYPSYYPPNIDCSWIIRVSSAQSGQRLSLKILAIQIQEKSPGSSKCDKDWLEIDGVRYC
KDISENGRNREYGHSVAINFHSDEFVTHRGFYIEYRAFSHTETCPRQFGCTDTERMVKSK
HAVFSFDFVEYCENINIGETVHAILCENFRKCENQGEKKKYRFREQSTSCTPEQLNCGDG
KCKHQYKNCEGDNSCGEDSNENNCCEINFIESCFPYTFKCLNGKCLLKPNPECDGKIDCT
DGSDEVNCACGRNLFKKNRIVGGEDAQSGKWPWQASLQIGAHGHVCGASVISKRWLLSAA
HCFLDSDSIRYSAPSRWRAYMGLHTVNEKSNHIAMRSIKRIIVHPQYDQSISDYDIALLE
METPVFFSELVQPICLPSSSRVFLYGTVCYVTGWGAIKENSHLAGTLQEARVRIINQSIC
SKLYDDLITSRMLCAGNLNGGIDACQGDSGGPLACTGKGNRWYLAGIVSWGEGCARRNRP
GVYTKVTALYDWIRQNTN
Download sequence
Identical sequences ENSGALP00000024780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]