SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000024798 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000024798
Domain Number 1 Region: 613-903
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-83
Family Protein kinases, catalytic subunit 0.00000000096
Further Details:      
 
Domain Number 2 Region: 28-200
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.34e-73
Family Ephrin receptor ligand binding domain 0.000000903
Further Details:      
 
Domain Number 3 Region: 324-529
Classification Level Classification E-value
Superfamily Fibronectin type III 5.44e-41
Family Fibronectin type III 0.0000547
Further Details:      
 
Domain Number 4 Region: 909-978
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000251
Family SAM (sterile alpha motif) domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000024798
Domain Number - Region: 253-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000879
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000024798   Gene: ENSGALG00000015403   Transcript: ENSGALT00000024844
Sequence length 983
Comment pep:known chromosome:Galgal4:1:88543354:88765491:1 gene:ENSGALG00000015403 transcript:ENSGALT00000024844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRRRLPLLLLCAALGSAGRLSARPGNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEH
YTPIRTYQVCNVMDHSQNNWLRTNWIPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFN
LYYMESDDDHLAKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEVREVGPVSKKGFYL
AFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNHSKEEEPPK
MYCSTEGEWLVPIGKCLCNAGYEERGFACQACRPGFYKASAGNVKCAKCPPHSSTYEDAS
LNCRCEKNYFRSEKDPPSMACTRPPSAPRNVISNINETSVILDWSWPLDTGGRKDVTFNI
ICKKCGGSSKICEPCSDNVRFLPRQTGLTNTTVTVVDLLAHTNYTFEIDAVNGVSDLSTL
SRQFAAVSITTNQAAPSPITVIRKDRTSRNSVSLSWQEPEHPNGIILDYEVKYYEKQEQE
TSYTILRAKSTNVTISGLKPDTTYVFQIRARTAAGYGTSSRKFEFETSPDSFSISSENSQ
VVMIAISAAVAIILLTVVVYVLIGRFCGYKKSKHGTDEKRLHFGNGHLKLPGLRTYVDPH
TYEDPNQAVHEFAKELDASNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKAGYT
EKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTV
IQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYT
TRGGKIPIRWTSPEAIAYRKFTSASDAWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEG
YRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPSSLKIITNAAARPSN
LLLDQSNIDISAFRTAGDWLNGFRTGQCKGIFTGVEYSSCDTIAKISTDDMKKVGVTVVG
PQKKIVSSIKTLETHTKNSPVPV
Download sequence
Identical sequences F1NJX6
9031.ENSGALP00000024798 ENSGALP00000024798 ENSGALP00000024798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]