SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000024809 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000024809
Domain Number 1 Region: 264-453
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-37
Family Laminin G-like module 0.00000586
Further Details:      
 
Domain Number 2 Region: 467-662
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.73e-26
Family Laminin G-like module 0.0000498
Further Details:      
 
Domain Number 3 Region: 42-94
Classification Level Classification E-value
Superfamily GLA-domain 5.72e-20
Family GLA-domain 0.00046
Further Details:      
 
Domain Number 4 Region: 119-245
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.87e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000024809
Domain Number - Region: 239-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000243
Family EGF-type module 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000024809   Gene: ENSGALG00000015409   Transcript: ENSGALT00000024855
Sequence length 665
Comment pep:known_by_projection chromosome:Galgal4:1:89043281:89077838:-1 gene:ENSGALG00000015409 transcript:ENSGALT00000024855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPRGGRCVPLLAGLAVALALAEAATFLSHQYASEFLARKRRANSFMEESKKGNLERECV
EELCNKEEAREIFENNPETEYFYPKYLSCLASYRAGVFRVPTVTPDSPANLRVCVSEISN
QCSPLPCHRDGYKECIDGQAKYTCICKPGWQGENCEEDINECEDINGGCSQRCSNLPGSY
RCLCEDGYFMHSNKRDCRDINECALHPNICGTAVCKNTLGKYECECAEGYKYNSTSKSCE
DIDECAENTCAQLCVNSPGSYSCYCDGKKGFKLSKDMKNCESVPVCIPLNLERNYELLYL
AEHFTGIYVLYLKFKLPNVTRFSAEFDFRTYDSEGIILYAESFDNTAWILLALRDGKIEI
QFKNEFGTKVTSGGKAINDGLWHIISVEELENSISVKIAKEAVMNINSPGTLFKQSHGFL
ETKVYIAGLPDKVGDTLIKQINPRLDGCIRAWNLMNQGHSGVKEVIQEKQSKHCLVTVER
GSFYPGTGMAQFDINYNNHDSAEDWLINVTMTIRPSTDTGVMFALVSNETVPLALSIVDS
NSSDSQEIIVTIGNITVARLESKKLCTPRKVQVGLLVTKQQLQLSVDSRTDQSNSEQLSV
LHQAMMTNVVTYLGGLPDVPLGATLVTAFYNGCMEVKVNSRQLDLDEAISKHNSIRSHSC
PLIME
Download sequence
Identical sequences E1C6L4
ENSGALP00000024809 XP_416641.2.86415 9031.ENSGALP00000024809 ENSGALP00000024809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]