SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025068 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025068
Domain Number 1 Region: 156-355
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.21e-54
Family Prokaryotic proteases 0.000000484
Further Details:      
 
Domain Number 2 Region: 368-463
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-19
Family HtrA-like serine proteases 0.0012
Further Details:      
 
Domain Number 3 Region: 29-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000345
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number 4 Region: 94-139
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000236
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025068   Gene: ENSGALG00000015575   Transcript: ENSGALT00000025114
Sequence length 466
Comment pep:known_by_projection chromosome:Galgal4:4:80438630:80461899:1 gene:ENSGALG00000015575 transcript:ENSGALT00000025114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSLLSPLLLLCLSRSRGSAELPAARAKCPTRCDVSKCPSPSCPSGYVPDRCNCCLICA
AGEGDSCGRKEDPPCGDSLDCRYPMGKRFAKGVCQCKLSVQVCGSDGRTYDNICQLKAVS
RKALQHGLPAVAQVQKGACESGHLQSSSPRYKFNFIADVVEKIAPAVVHIELFLRHPLFG
RNVPLSSGSGFIMSDSGLIVTNAHVVSSTNAISGRQQLKVQLQNGDTYEATIRDIDKKSD
IATIKIHPKKKLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRDGKELGLR
DSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRITQFLTESLDK
QNKDSKKRFIGIRMLTITPALVEELKHNNADFPDVRSGIYVHEVVPNSPSHRGGIQDGDI
IVKVNGRPLMTSSDLQEAVMNESPLLLEVRRGNDDLLFNIEPEIVM
Download sequence
Identical sequences XP_015141331.1.86415 ENSGALP00000025068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]