SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025139 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025139
Domain Number 1 Region: 321-578
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.93e-80
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 201-312
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-33
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 3 Region: 40-90
Classification Level Classification E-value
Superfamily Kringle-like 2.63e-16
Family Fibronectin type II module 0.0029
Further Details:      
 
Domain Number 4 Region: 97-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000119
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000025139
Domain Number - Region: 136-175
Classification Level Classification E-value
Superfamily FnI-like domain 0.00154
Family Fibronectin type I module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025139   Gene: ENSGALG00000015623   Transcript: ENSGALT00000025185
Sequence length 583
Comment pep:known_by_projection chromosome:Galgal4:4:81495986:81536120:-1 gene:ENSGALG00000015623 transcript:ENSGALT00000025185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKACAPFALVLALALSSAYMKKHHKSGAGRGSKHEFTRLQVFTEDGNLCTFPFRYGGRLY
HSCLSNLFSRKKWCSTTRNYDRDRKWGYCTLLSTEHSDYCANNPCQNGGTCFLAHGHRTY
HCACPEEFTGRDCQMKKCFDDSLYEFFDVDVSWSRVKQGAVEQCICVDGQMECQRVEHKS
CVHDPCMNGGECKTIAFSGRTVCDCKEPFVGKYCNIVPNHHCYRGNGTEYRGTANTTISG
HSCLPWNSDLLYRELHVDSVEKAVQLGLGPFPYCRNPDEDEKPWCYIMKDNSLSWEYCNI
PSCASRERRPPVPEDIDTFAVARRPCGRRHKKRSFVRPRIIGGSSSLPGSHPWTAAIYIG
ESFCAGSLIQTCWVVSAAHCFANSPHKSSIKVVLGQHFFNRTTDVTQTFEIEKYILYPQY
SVFSPTEHDIALIKLKKNGQRCAVKSQFVQPICLPETNTVFPDEFKCQISGWGHKHENIT
GYSDVLQETLIPLIPEEKCRSPEIYGTEISENMFCAGYFDSKSDACQGDSGGPLACEKNE
ISYLYGVISWGDGCGRVNKPGVYTRVTNYVNWINERIAPRKTT
Download sequence
Identical sequences E1BZN8
ENSGALP00000025139 XP_420819.4.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]