SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025153 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025153
Domain Number 1 Region: 318-478
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000187
Further Details:      
 
Domain Number 2 Region: 157-316
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.8e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000304
Further Details:      
 
Domain Number 3 Region: 119-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000121
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 76-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000689
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 24-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000917
Family EGF-type module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025153   Gene: ENSGALG00000015630   Transcript: ENSGALT00000025199
Sequence length 480
Comment pep:known_by_projection chromosome:Galgal4:Z:61983370:62255549:1 gene:ENSGALG00000015630 transcript:ENSGALT00000025199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRAVLAWLVLCGSLAAPRLARGDLCDSNPCKNGGICLSGLNDDFYSCECPEGFTDPNCS
SVVEVASIEEEPTSAGPCLPNPCHNGGMCEISEAYRGDTFIGYVCKCPEGFNGIHCQHNV
NECEAEPCKNGGICTDLVANYSCECPGEFMGRNCQQRCSGPLGIEGGIVSNQQITASSTH
RALFGLQKWYPYYARLNKKGLVNAWTAAENDRWPWIQINLQKKMRVTGVITQGAKRIGSP
EYVKSYKIAYSNDGKSWTMYKVKGTNEDMVFRGNVDNNTPYANSFTPPIKSQYIRLYPQV
CRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSVFRTLNMDMFAWEPRKARLDK
QGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWI
IYQDEKQKKDKVFQGNFDNDTHRKNVIDPPIYARHIRIIPWSWYGRITLRSELLGCTEQD
Download sequence
Identical sequences F1NCN3
ENSGALP00000025153 XP_424906.3.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]