SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025162 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025162
Domain Number 1 Region: 76-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000012
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000025162
Domain Number - Region: 37-79
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0183
Family Somatomedin B domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025162   Gene: ENSGALG00000015634   Transcript: ENSGALT00000025208
Sequence length 265
Comment pep:known_by_projection chromosome:Galgal4:2:117350076:117361786:-1 gene:ENSGALG00000015634 transcript:ENSGALT00000025208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVALSGALCLGLLWRLWAGAGGSCSERCCQGRDAACVSSGWREDGGYGSCYCDGGCRR
TRDCCHDHGHACPAHPCIVGEWSHWSGCAEQCKPSLRIRRRYVQQEPTNAGEPCPALEEK
AGCLEYLTYQGQDCGHEHVPAFITTSEYDKERKLRAASSPWPSDKETGYCVEFKTESLSH
YCALENRPYARWMQYLREGHTVCVACQPPAMNTDTHRCSGDGHNADGGKILHWEAVGNSR
CQGTWKKIRQLKQCSCPLVHSFIFT
Download sequence
Identical sequences A0A1D5P6W9
ENSGALP00000025162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]