SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025225 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025225
Domain Number 1 Region: 125-372
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-69
Family Nuclear receptor ligand-binding domain 0.00000000318
Further Details:      
 
Domain Number 2 Region: 57-139
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-30
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025225   Gene: ENSGALG00000015670   Transcript: ENSGALT00000025271
Sequence length 454
Comment pep:known_by_projection chromosome:Galgal4:2:118421432:118442821:1 gene:ENSGALG00000015670 transcript:ENSGALT00000025271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRVSEPILDMEMANYSEVLDPTYTTLEFETMQILYNGNDSSGEPLNMNATDSGISSLCA
ICGDRATGKHYGASSCDGCKGFFRRSIRKNHVYTCRFSRQCVVDKDKRNQCRYCRLKKCF
RAGMKKEAVQNERDRISTRRNTFDGCNIPSISTLSQAEALSRQISVSSPGASTDINAKKI
AGISDVCESMKQQLLVLVEWAKYIPGFCELPLDDQVALLRAHAGEHLLLGAAKRSMAYKD
ILLLGNNYIIHRNSTEVEISRVANRILDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGL
SNPVKIKNMRYQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQLVKLFG
IVKIDSLLQEMLLGGTSNDASHLHHPVHPHLAQDPLTGQTILISSMSAPVHAEQISTPET
PLPSPPQGSGQEYKMSSNQASVIAQQSILKQKSL
Download sequence
Identical sequences A0A1D5PAS5
XP_425924.4.86415 ENSGALP00000025225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]