SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025303 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025303
Domain Number 1 Region: 36-186
Classification Level Classification E-value
Superfamily C-type lectin-like 2.41e-28
Family C-type lectin domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025303   Gene: ENSGALG00000015720   Transcript: ENSGALT00000025349
Sequence length 290
Comment pep:known_by_projection chromosome:Galgal4:1:98864912:98893667:1 gene:ENSGALG00000015720 transcript:ENSGALT00000025349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGLGLAAVLAVAALYGSGALGGRVLSGQKVCYGGFKRSCYKIAYFQDLSRRVGFQEAR
QACEMDGGALLSLESEAEQQLIENMLQNLTKSGSGISDGDFWIGLWRSSDGLATSSACPD
LYHWADGSISPFRNWYTDEPSCGSEACVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNFI
CKYGPDNVLEKELGDRAEPDYGIFPTVPAGNPYDTNKPEDQYHVIATETGIIPNLIYVVI
PTIPLLLLILVAFGTCCFQMLHKREARRNCFKDPSPLSSECLAESLNSNL
Download sequence
Identical sequences ENSGALP00000025303 XP_004938412.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]