SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025304 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025304
Domain Number 1 Region: 1425-1625
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.78e-39
Family Pentraxin (pentaxin) 0.001
Further Details:      
 
Domain Number 2 Region: 68-251
Classification Level Classification E-value
Superfamily vWA-like 4.31e-38
Family Integrin A (or I) domain 0.00082
Further Details:      
 
Domain Number 3 Region: 2770-2839
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.21e-19
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 2145-2214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.61e-19
Family Complement control module/SCR domain 0.00076
Further Details:      
 
Domain Number 5 Region: 3236-3299
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.25e-19
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 6 Region: 3294-3361
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.51e-19
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 1788-1856
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-18
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 8 Region: 2886-2949
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.34e-18
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 9 Region: 3352-3421
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.04e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 10 Region: 2712-2781
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.06e-17
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 11 Region: 2380-2449
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.21e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 12 Region: 1846-1909
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 13 Region: 1962-2030
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.61e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 14 Region: 2496-2559
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.25e-17
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 15 Region: 2829-2891
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.51e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 16 Region: 2944-3008
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.62e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 17 Region: 3411-3477
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.14e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 18 Region: 2438-2507
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-16
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 19 Region: 3529-3588
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.92e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 20 Region: 2554-2622
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.8e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 1683-1746
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000375
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 22 Region: 1295-1421
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000643
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 23 Region: 1906-1969
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000792
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 24 Region: 2203-2274
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000115
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 25 Region: 2265-2328
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 26 Region: 3059-3122
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000057
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 27 Region: 3119-3182
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000987
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 28 Region: 2663-2723
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000012
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 29 Region: 1637-1700
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 30 Region: 368-439
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 31 Region: 429-496
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000375
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 32 Region: 2323-2388
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000445
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 33 Region: 2019-2087
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000334
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 34 Region: 3004-3064
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000445
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 35 Region: 3470-3532
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000945
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 36 Region: 3178-3242
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000153
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 37 Region: 987-1131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000186
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 38 Region: 1232-1274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 39 Region: 2084-2151
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000208
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 40 Region: 1196-1235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000003
Family EGF-type module 0.012
Further Details:      
 
Domain Number 41 Region: 1742-1785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000024
Family EGF-type module 0.03
Further Details:      
 
Domain Number 42 Region: 269-425
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000165
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 43 Region: 483-545
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000124
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000025304
Domain Number - Region: 3619-3648
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000231
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 3580-3616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000279
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 3648-3679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000302
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 719-780
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00556
Family Complement control module/SCR domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025304   Gene: ENSGALG00000015721   Transcript: ENSGALT00000025350
Sequence length 3687
Comment pep:known_by_projection chromosome:Galgal4:Z:66365631:66491486:-1 gene:ENSGALG00000015721 transcript:ENSGALT00000025350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPLVALCCWGGLSLPLSLALSAPQGRAAALASPALASPAPAPPLPDTTESKVEKLGRAF
KRQVRRLRARSGRLELVFLVDESSSVGPANFLSELRFVKKLLSDFPVVPAATRVAIVTFS
SRSNVVPRVDYISRRRPQQHKCALLGREIPAIAYRGGGTYTKGAFQQAAQILRHARGNST
KVIFLITDGYSNGGDPRPIAASLRDFGVEIFTFGIWQGNIRELNDMASHPKEDHCYLLHS
FTEFEALARRALHEDLPSGSYIQEDISHCSYLCEANENCCDIMASCKCGTHTGQFECICE
KGYYGKGLQHECTACPPGTYKPESSPGGISTCISCPDENHTSPPGSTSIEDCACQEGYRA
VGQTCEVVHCPELKPPENGYFVQNVCNNYFNAACGIRCKAGFDLVGSSIRLCQPNGQWSG
SEATCRVRTCPKLWAPENGHINCSTADISYKTECFVTCNEGYKLEGNAKLTCQGTSQWDS
KEPKCVEMHCPVFQKPAGVTILPPKCGLEPAVSGTVCQLSCPQGFILSGAREELRCISSG
RWSANIQDALCKDIEAPQIQCPENIETETLEHQNAANISWQVPVAEDNSGDEVSVHVTPT
FIPPYLLPIGEVAITYRAVDKSGNEASCTFSVKVIDAEPPVIDRCRSPPPIQAVENEYPA
TWEEPQFSDNSGAPLTITRSHEPGDLFPKGETTVQYIALDPSGNNRTCEIHIVIKGSPCE
ISFKPVNGNFTCTSDEVGVNCTLQCAEGYSFSEGSSENYYCAYEDGVWKPPYSPEWPDCS
LNRFANHGFKSFEMLYKATRCDDNSLLNGFSDAFQSALGKMVPSFCNDVDDIDCRLEDQT
QKHCLEYNYDYENGFAIGPAGWGAANQLDYSYDDFFDTVQEEGLSKHLSAFAKAAPTRVK
RHKKLNVPMTDHKIKLIFNITASVPLPDERNDTLELENQKRLLKTLETITNRLNRTLNKE
PMYSFQFASELIVADSNSLETEKAFLFCRPGSVLKGRMCVNCPLGTYYSLEHHACESCWT
GSYQDEEGQLECKSCPSGSYTEYLHSRSISECKVQCKQGTYSPNGLETCETCPLGTYQPA
FGSRNCISCPEDTSTVKRGAVDVSACGVPCSAGEFSRTGLTPCYPCPRDYYQPDPGKSYC
LSCPFYGTTTIIGARSITDCSSFGSTFSAAEESVMMIPASPENISKQYKVSSQVFHECFL
EPCHNNGTCKQLGSGYICICPIGYTGLKCETEVDECKSSPCHNNGVCKDGIGTFVCHCKP
GYSGLLCEKDINECTSSPCLNGGHCVDERNGYHCTCAKGFTGAHCESEVNECLSNPCLNR
AVCEDRVGGFSCKCLPGFTGVLCERNIDECLSRPCRNGATCRDGINSFRCLCVTGYTGPN
CEVNINDCASSPCLNHATCVDALNSYVCKCPPGFTGSKCETEQSSGFNLDFEVSGIYGYV
MLDGILPSLGDITCAFWMKSTDTTNYGTPISYAVENGSDNAFLLTDYNGWVLYVNGKERI
TDCPSVNDGNWHHIAVTWTCMDGAWRVYIDGKLSDGGSGLSVGSKIPGGGALVLGQEQDQ
KGEGFNPAESFVGSISQLNIWDRVLSPQQVKSLATSCPEELQKGNVLAWPDFLPGVVGRV
KIDYKSIFCADCPSLQGSVPHLRASSSDLKPGSKVSLSCDPGFQIVGNSVQHCLNMGQWT
RPFPRCERISCGVPPPLENGGYAAEDFFAGSTITYQCNSGYYLLGDFEMFCRDNGSWSSI
SPSCLDVDECAVGSDCDEHASCLNTNGSYVCTCIPPYTGDGKKCTEPVKCRNPGNPANGH
MYGDTYSVGSQVTFSCEKGFQLTGVTKLTCMESGEWSHSIPYCEAISCGRPIIPENSAIW
GSNFTYRSKVIYRCKDGYSIVGEKEIMCLANGVWNHPPPSCEMVTCPIPQDISNGKYTLT
GTTYLSSVSYSCDNGYSLQGPSVLVCASSGNWNSTPPACSIVSCGSPPAIKDAVIEGNNF
TFGNTVSYTCKEGYTLVGPATIECLASGEWSVSHQQCLAVSCDEPPHVENASPENGHRLY
GDIAYYFCSDGYSLADNSQLLCNAEGKWVPPEGKKMPYCVADFCEKPSTVSYSILESISK
ARFPAGSIVSFKCMEGFVLNTSAKIECLRGGIWNPSPLSIQCIPVRCGEPPNISNGYASG
TNYSFGAVVAYSCNKGFYIKGEKKRTCEATGSWSGNLPTCHPVSCGEPPQLENGFIKETT
GHFFENQANYQCESGYHLVGNSVFICQANRQWYSESPPRCVPLSCGKPPPIQHGYSRGET
FDTGSKVEFFCEEGYELIGDVSWTCQKSGKWNKKQSPKCMPTKCPEPPLAENQLVLREVT
YQVGVVQFSCKEGYVLHGSSVLKCLPSQQWNDSFPFCKVVQCPAPPYVPFSDTLTSSLYF
GSTVKYICVDGFLLKGEPTIRCQADGSWSLPLPECIPVECPQPEEIQNGIVDVQGLTFLS
TALYTCKPGFELVGNTTILCGEDGQWLGGRPVCKPIECPRPKKILNGRYSFTNFHYGQTV
KYSCDRGFQLQGEETLSCLETGEWSTDAPSCKAINCQPPQPIENGFVEGADYSYGAMVIY
SCVPGFQLSGLAMQTCEESGWSSSTPTCLPTDCGLPPHIDFGEYMQVRHWEKHSNKESVT
ESPSLSRTLLGDNLKNLKSSSKENSAMQLTTFLFGTIILYTCYSGYELLGNPVLACQEDG
AWNGTAPSCISIECTLLSPPDNGFLHFTENTPGSMVQYTCKPGFTLIGSDTRLCLPNRQW
SDTAPHCKAITCSSPTQLMNGKVRGENYTYGSVVYYECDPGYQLNGPTERRCLENQKWDG
SEPICIPVSCSPPLVLENGQVAGEEYTFQKRIEYSCNEGFVLDGDRSRVCLTNGSWSGIT
PVCKAVTCPVPPPLPNGRMSGSDFGFRKEVQYHCNEGYNLQGVSTLTCQSDGNWDSEAPR
CEPVICGPPEDISHGFLNGSDFTYGEYAQYVCFPGYELHGNPLRQCLSNGSWSGSLPSCL
LCECPAPQVQNGVVLGEDFSCGKSAQFQCLEGFKLLGPSEITCETAGKWSAGFPRCGQIS
CGSPPIIPNTFINGSSSADENTVIYTCLTGFVMRGSPELTCVETGVWKKPYPSCELLSCG
PPPSVPNAEVLGSTHTYGSKVQYRCLEGYTMVTEVDVCTCQEDGQWSPQSISCCPRKCSL
PGNITHVIVLGDNFTVSTNITLSCVEGYTLVGASTSTCKESGVWMPEFSDDICIPVSCGI
PESPEHGFVVGTKFSYKDVVLYKCDPGYELQGDTERTCQEDKLWSGSVPTCRRVSCGPPE
VIENGSVQGEEFLFGSEAFYSCDPGFELQGPSRRICHVDKKWSPSAPVCRRITCGLPPSI
EKAEAISTGNTYKSNVTFVCSSGYHLVGPQNITCLANGSWSKPLPLCEETRCKLPLSLLN
GKAIYENNTVGSTVAYFCKSGYSLEGEPTAECTRDGRWSNPLPLCKPNPCPVPFIIPENA
LLSEVDFYVGQNVSIRCREGYQLKGQAVITCNADETWTPTTAKCEKISCGPPAHIENAFI
RGSFYQYGDMITYSCYSGYMLEGPLRSICLENGTWTTPPTCKAVCRFPCQNGGVCERPNA
CSCPDGWMGRLCEEPICILPCLNGGRCVAPYKCDCPPGWTGSRCHTAVCQSPCLNGGKCI
RPNRCYCPSSWTGHDCSRKRKAGFYHF
Download sequence
Identical sequences F1NE59
XP_015136185.1.86415 ENSGALP00000025304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]