SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025323 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025323
Domain Number 1 Region: 12-268
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.39e-78
Family Eukaryotic proteases 0.00000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025323   Gene: ENSGALG00000015730   Transcript: ENSGALT00000025369
Sequence length 274
Comment pep:known_by_projection chromosome:Galgal4:1:98898052:98906375:-1 gene:ENSGALG00000015730 transcript:ENSGALT00000025369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFYKSSFFYLKYIYAFILACGKRLEIENKGTRIVGGSDARREAWPWIVSLHFNSRPVCG
ASLVNEEWLVTAAHCVYGRQLQPSTWKAVLGLYDQSNMTDASTVVRNIDQIVINPHYNKV
TKDSDIALMHLQYEVQYTDMKVGKLCWENMLLIPQELLRSTNWGELHFQVSSPTSNILQE
AVVPLISNEKCQEWLPEYSISKNMICAGYDMGGVDSCQGDSGGPLMSEDGNQWVLVGVTS
FGYECALAQRPGVYVRVAMFVDWIQKIIYYLDIP
Download sequence
Identical sequences ENSGALP00000025323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]