SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025419 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025419
Domain Number 1 Region: 193-404
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.65e-52
Family Reprolysin-like 0.00099
Further Details:      
 
Domain Number 2 Region: 495-551
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 6.15e-16
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 856-918
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000209
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 4 Region: 808-861
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000051
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025419   Gene: ENSGALG00000015792   Transcript: ENSGALT00000025465
Sequence length 919
Comment pep:known_by_projection chromosome:Galgal4:1:102362466:102371203:-1 gene:ENSGALG00000015792 transcript:ENSGALT00000025465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRNWKLPFICSQYCGRKMYXQRPAARQALVLPRRLGSAGGRERFRLEAFGERLTLELEPD
SSFLAPDFTLQYLGGPPPPSSSSPPPGDDLARCFYSGTVNRDPGSAAALSLCAGMRGAFS
LRGREYLIQPAPGAAAHRLGPHLLRVRGPRAPAASRCAVTEQGEKRGRGGGARAGAGALG
AQTRSKRKKRFVSSPRYVETMLVADQSMAEFHGSGLKHYLLTLLSVAAKLYKHPSIRNSI
SLVVVKIMVIYEERKGPDISSNAALTLRNFCSWQKQHNPPSDRHAEHYDTAILFTRQDLC
GAKTCDTLGMADVGTVCDLNRSCSIIEDDGLQAAFTTAHELGHVFNMPHDDAKQCAGING
ISRDFHMMASMLSNLDRSQPWSPCSAYMITTFLDNGHGECLLDKPHRPIQLPSDLPGTLY
DANRQCQFTFGDESKHCPDAASTCTTLWCTGTSGGLLVCQTKHFPWADGTSCGEGKWCMN
GKCVNKTEKKHYDTPVHGSWGSWGAWGECSRSCGGGVQYSFRECDNPVPRNGGKYCEGKR
VQYRSCNIEDCPDNNGKTFREEQCEKHNEFSKSTFGSGPAVEWTPKYAGVSPKDRCKLVC
RAKGTGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAGCDRMIGSNKKFDKCGICGGNGS
TCKKVSGTFVRAKPGYHDVVTIPAGATNIEVKQRNHRGARHDGSFLAIKAADGTYVLNGD
YTLSTLEQDITYKGSVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGDLPQPKIKFTYFV
KKPAQPASEKVPSKKKESFNAIKEIISSEWVIEEWGECSKSCGSGWQRRAVECRDPRGRP
ATDCARELKPSDIRPCADIPCPQWQLGDWSACSKTCGKGFKKRLLKCISYDGGVLPQESC
EPSKKPKHLIDFCNVTDCS
Download sequence
Identical sequences ENSGALP00000025419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]