SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025504 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025504
Domain Number 1 Region: 122-192,243-394
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.57e-29
Family Eukaryotic proteases 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025504   Gene: ENSGALG00000015847   Transcript: ENSGALT00000025551
Sequence length 413
Comment pep:known_by_projection chromosome:Galgal4:3:77130273:77137465:-1 gene:ENSGALG00000015847 transcript:ENSGALT00000025551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHMLLLFIFFMPALGLANGTGTEQDFTWHLKKVPQIVSERTFSLDSPKFEAKPNLELNS
VCGIECQRKLPVPSLSDLKDLLSYETIFENGTRILTEVNVLGLTLDPAGNTTAHKSLRKK
RQIYGMDSRFSIYDKRFMTNFPFNTAVKISTGCSGILISPKHVLTAAHCLHDGKDYVKGS
KRLRVGLMRTKSRGDGRKRKGAKRSRREATETQEDPEVATGLRRRSRGGGRKQRRSGRKQ
GSSDGMPSFQWTRVKSTHIPKGWFKGFSGDVALDYDYAVLELKRPHKRKYMELGISPTIK
MMPGSMIHFSGFDNDRSGQLVYRFCSISDESNDLFYQYCDAEPGSTGSGVYLRLKEPNKR
KWKRKIIAVFSGHQWVDVNGEQQDYNVAVRITPLKYAQICFWIHGNDENCAQG
Download sequence
Identical sequences E1BQU9
ENSGALP00000025504 9031.ENSGALP00000025504 XP_004940466.2.86415 XP_004940467.1.86415 XP_015140203.1.86415 XP_419860.1.86415 ENSGALP00000025504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]