SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025859 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025859
Domain Number 1 Region: 139-243
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-31
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 343-454
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 534-572
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 249-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 296-338
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000127
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 495-533
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 7 Region: 458-495
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000106
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025859   Gene: ENSGALG00000016077   Transcript: ENSGALT00000025906
Sequence length 942
Comment pep:known_by_projection chromosome:Galgal4:2:129771364:129835051:-1 gene:ENSGALG00000016077 transcript:ENSGALT00000025906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSCCETSTTHILSVYMEKMSAISFFTLETGLRTPYPSEQEVLGWCQAQGKPAKSLRAAA
KLKVVSEEIARPRQGFVPALCSCSAWEAEVFQGSNQEMVLLQNILKMCIFQECQRLLSVS
FGGNKGTDRRACGDIPEQIRSPSGTITSPGWPSEYPARINCSWYIHANPGEIITISFQDF
DVQGSRRCSSDWLTIGSYKNIEGYRACGSSIPSPYISSQDHVWIRFHSDDSISRKGFRLA
YFAGKSDEPNCDCDQFHCANGKCIPESWKCNNMDECGDNSDEEICAKANPPTISSFQPCA
SNQFQCLSRFTKLYTCLPESLKCDGNIDCLDLGDEIDCEVPTCGQWLKYFYGTFSSPNYP
DFYPPGSNCTWLIDTGDHRKVILRFTDFKLDGTGFGDYVKIYDGLEENPRRLLRVLTAFD
SHAPLTVVSSSGQIRVHFCADKVNAARGFNATYQVDGFCLPWEIPCGGNWGCYTEQQRCD
GYWHCPNGRDETNCTMCQRDEFPCSRNGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNF
HCKNNRCVFESWVCDSQDDCGDGSDEENCPVIVPTRVITAAVIGSLICGLLLVIALGCTC
KLYSLRMFERRSFETHLSRVEAELLRREAPPSYGQLIAQGLIPPVEDFPVCSPNQASVLE
NLRLAVRSQLGFTSIRLPITGRSSNIWNRIFNFARSRHSGSLALVSADGDDVASQSTSRD
AERSNTHRSLFSVESDDTDTENERRDTAGAVGGVAATLPQKVPPATAIEATVGACGSSSA
QSGSGGNTDSGREVTSIEPPGTSPARHQLTSALSRMTQGLRWVRFTLGRSSSVNQNQSPL
RQLDNGVSGREEDDDVEMLIPVSDVASDFDMNDCSRPLLDLSSDQEPGLRQPYSATHHGV
RSCNRDGPCESCGIVHTAQIPDTCLEATVKNETSDDEALLLC
Download sequence
Identical sequences ENSGALP00000025859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]