SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025912 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025912
Domain Number 1 Region: 31-110
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.0041
Further Details:      
 
Domain Number 2 Region: 98-170
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000033
Family Fibronectin type I module 0.04
Further Details:      
 
Domain Number 3 Region: 202-245
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000131
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025912   Gene: ENSGALG00000016112   Transcript: ENSGALT00000025959
Sequence length 351
Comment pep:known chromosome:Galgal4:2:136064124:136069743:1 gene:ENSGALG00000016112 transcript:ENSGALT00000025959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGGGQGLPVLLLLLLLLRPCEVSGREAACPRPCGGRCPAEPPRCAPGVPAVLDGCGCC
LVCARQRGESCSPLLPCDESGGLYCDRGPEDGGGAGICMVLEGDNCVFDGMIYRNGETFQ
PSCKYQCTCRDGQIGCLPRCNLGLLLPGPDCPFPRKIEVPGECCEKWVCDPRDEVLLGGF
AMAAYRQEATLGIDVSDSSANCIEQTTEWSACSKSCGMGFSTRVTNRNQQCEMVKQTRLC
MMRPCENEEPSDKKGKKCIRTKKSMKAVRFEYKNCTSVQTYKPRYCGLCNDGRCCTPHNT
KTIQVEFRCPQGKFLKKPMMLINTCVCHGNCPQSNNAFFQPLDPMSSEAKI
Download sequence
Identical sequences A0A1D5P2P1
ENSGALP00000025912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]