SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025992 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025992
Domain Number 1 Region: 391-447
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000497
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 2 Region: 447-502
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000118
Family TSP-1 type 1 repeat 0.00042
Further Details:      
 
Domain Number 3 Region: 502-557
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000017
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 4 Region: 250-301
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000196
Family TSP-1 type 1 repeat 0.00089
Further Details:      
 
Domain Number 5 Region: 339-388
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000235
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000025992
Domain Number - Region: 927-1182
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00137
Family Rhodopsin-like 0.034
Further Details:      
 
Domain Number - Region: 574-621
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00139
Family Hormone receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 32-99
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0174
Family Spermadhesin, CUB domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025992   Gene: ENSGALG00000016160   Transcript: ENSGALT00000026039
Sequence length 1595
Comment pep:known_by_projection chromosome:Galgal4:2:147221608:147426587:1 gene:ENSGALG00000016160 transcript:ENSGALT00000026039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSIGSALNLLLVSPLYFVWTVVALDLAQTPCTTLVQGKFFGYFSSFAVFPLNSSLCSWI
IQNPDPRRYTLYMKILKPTGICDHQHIRTYQFDSFLESTRTYLGMESFDDVLKLCDGSTR
YAFLQSNKQFLQMKQTAPPGVENGPVRWKPIKAQERDFSVEYLVVGNRNPSKAACQMLCK
WLDACLAISSSSHPCGIMQTPCSCSGGEVLDQASEILGFPKKKEDCYKDGIYLENCLSSP
KDSSGVEFLGGWNTWSAWGDCTKDCGGGLQTRMRTCKPLPNEGLACEGVLEEGRLCNRKA
CNTNGRYNSRSQSLRSTDNRKREDTDELQHYGYPAPQIGDPAAEEWSPWSVCSTTCGEGW
QTRTRFCVSSSYSTQCSGPLREQRQCNNSAICPVHGTWDEWSPWSLCSSTCGRGYRDRTR
TCKPPQFGGNPCEGPEKQTKFCNIALCPVDGNWNEWSSWSSCSASCSNGTQQRTRECNGP
SYGGAECQGHWVETRDCFLRQCPVDGKWQAWGVWGSCTTTCGGGTQRRDRVCYGPFFGGE
TCQGPKEEYRQCNDRKCPEPHEICDEESLASVVWKETPAGDAAAVRCPRNATGLILRRCT
LDEEGIAYWEPPTYVKCVSIDYRNIQMMTREHLSKAQRGLMGDGLSEVLQNLVEISQDGT
SYSGDLLSTIDVLRNMTEIFRRAYHSPTSGDVQNFVQIISNILSEENRDKWEEAQLIGPN
AKELFRLVEDFIDVIGFRMKDFRDSYQVTDNLVLGIHKLPANAATDITFPMKGWRGMVDW
AKNSEDKVTVSKSILSSGLTETDDSSVFVVGTVLYRNVGNILSLQRNSTVLNSRVISVTV
KPFPRSLLTPLEIEFSHLYNGTTNQTCILWDETDSRASASASLPGAWSWRGCRTVPLDAS
RTKCLCDKLSAFAILAQLSPDMNMEKVLVPSVTLIVGCGVSSLTLLLLIIIYVSVWRYIR
SERSVILINFCLSIISSNALILIGQTQTRNKVICTLVAAFLHFFFLSSFCWVLTEAWQSY
MAVTGRLRNRIIRKRFLCLGWGLPALVVAISVGFTKAKGYGTVNYCWLSLEGGLLYAFVG
PAAAVVLVNMVIGILVFNKLVSKDGITDKKLKERAGQMAVPLYGMTLKCSKCGVVSSAEV
SATATSNAMASLWSSCVVLPLLALTWMSAVLAITDRRSALFQILFAVFDSLEGFVIVMVH
CILRREVQDAVKCRVVDRQEEGNGDSGGSFQNGHAQLMTDFEKDVDMACRSGEHITVLNK
DITACRTSTITGTLKRPSLQDEEKLKLNHQKGSSNFNSLPANVSKLHLQGSPHYLGAINL
NEFSNHSLTLKKDKNQPPKSIYICDGDIFKKLDSELSRAQEQTLDTSYVILPTNTSTLRA
KPPKDESKYSINIDQMPQTRLIHLSMATDPGFVVKSPPREPVTMTCSEVQGSPMIQQQQQ
LPPQNIPSESQIPNSLCDTGDSGNSGVVSKSETVSTLSMSSLERRKSRYAELDFEKIMHT
RKRHQDMFQDLNRKLQHAEKEKESPTTDSKQEKQQTPNKRPWEGIRKVQSPPSWVKKDIE
PVAQSPLELKTVEWEKTGATIPLVGQDIIDLQTEV
Download sequence
Identical sequences ENSGALP00000025992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]