SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000026022 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000026022
Domain Number 1 Region: 151-206
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000889
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 2 Region: 206-261
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000144
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 3 Region: 103-146
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000288
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 4 Region: 261-316
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.00098
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000026022
Domain Number - Region: 685-874,903-984
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0146
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000026022   Gene: ENSGALG00000016176   Transcript: ENSGALT00000026069
Sequence length 1330
Comment pep:known_by_projection chromosome:Galgal4:3:82664538:83111962:-1 gene:ENSGALG00000016176 transcript:ENSGALT00000026069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTKCTCPQHLGEWGIDDQSLVLLNNVVLPLNEQTEGCLTQELQTTQVCNLTREAKRPPK
EEFGMMGDHTIKSQRPRSVHEKRVPQEQADAAKFMAQTGESGVEEWAQWSTCSVTCGQGS
QVRTRTCVSPYGTHCSGPLRESRVCNNTALCPVHGVWEEWSPWSLCSFTCGRGQRTRTRS
CIPPQYGGRSCDGPETQHKPCNIALCPVDGQWQEWSPWSQCSVTCSNGTQQRSRQCTAAA
HGGSECRGPWAESRECYNPECTANGEWNQWGHWSGCSKSCDGGWERRIRICQGAAVTGQQ
CEGTGEEVRRCSEQRCPAPYEICPEDYLMSMVWKRTPAGDMAFNRCPLNATGTTSRRCSL
SVHGVAFWEHPSFARCISNEYRHLQHSIKEHLAKGQRMLAGDGMSQVTKTLLDLTQRKNF
YAGDLLISVEILRNVTDTFKRASYIPASDGVQNFFQIISNLLDEENKEKWEDAQQIYPGS
VELMQVIEDFIHIVGMGMMDFQNSYLMTGNVVASIQKLPAASVLTDINFPMKGRKGMVDW
ARNSEDRVVIPKNIFTPMSTELDESTVFVLGAVLYKNLELILPTLRNFTVVNSKIIVVTI
RPEPKTTDSFLEIELAHLSNGTLNPYCVLWDDSRTNDSLGTWSTQGCKTVLTDASHTKCL
CDRLSTFAILAQQPREIIMESSGTPSVTLIVGSGLSCLALVTLAVVYAALWRYIRSERSI
ILINFCLSIISSNILILVGQTQTHNKGICTTTTAFLHFFFLASFCWVLTEAWQSYMAVTG
KIRTRLIRKRFLCLGWGLPALVVAISIGFTKTKGYGTAHYCWLSLEGGLLYAFVGPAAAV
VLVNMVIGILVFNKLVSRDGILDKKLKHRAGQMSEPHSGLTLKCAKCGVVSTTALSATTA
SNAMASLWSSCVVLPLLALTWMSAVLAMTDKRSILFQILFAVFDSLQGFVIVMVHCILRR
EVQDAFRCRLRNCQDPINADSSSSFPNGHAQIMTDFEKDVDIACRSVLHKDIGPCRAATI
TGTLSRISLNDEEEEKGPNPEGMSYSTLPGNIISKVIIQQPTGLHMPMSMSELANQCLKK
DNSELRRTVYLCTDDNLRGADMDIVHPQERMIESDYIVMPRSSVNTQPSLKDESKISIGM
DTLPHERLLHYKVNPEFNMNPSVMDQFNINLDQHLPTQEHMQSLPFEPRTAVKNFIASEL
DDNAGLSRSETGSTISMSSLERRKSRYSDLDFEKVMHTRKRHMELFQELNQKFQTLDRFR
DVPKSGSMENSAPNKVPWDNFKTTGEYQHYTTINVLDTEAKDTLELRPAEWEKCLNLPLD
VQEGDFQTEV
Download sequence
Identical sequences ENSGALP00000026022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]