SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000026026 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000026026
Domain Number 1 Region: 16-144
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000675
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 486-618
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000138
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 689-732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000599
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 4 Region: 614-656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000031
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 5 Region: 257-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000111
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 139-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000339
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 411-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000644
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 8 Region: 294-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000101
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 9 Region: 651-693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000138
Family EGF-type module 0.014
Further Details:      
 
Domain Number 10 Region: 217-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000214
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 11 Region: 337-366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000803
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 12 Region: 380-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000173
Family EGF-type module 0.035
Further Details:      
 
Domain Number 13 Region: 454-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000804
Family EGF-type module 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000026026   Gene: ENSGALG00000016183   Transcript: ENSGALT00000026073
Sequence length 761
Comment pep:novel chromosome:Galgal4:3:84449717:84579680:1 gene:ENSGALG00000016183 transcript:ENSGALT00000026073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCLLRLNVIMFLYFSSGFTGQFCEADVAACLSQPCGASSICKDMSDGYVCFCAPGFIGNN
CEIEVDECLSDPCHSGATCIDHLNGFSCICQGGFQGTTCETNINECHSSPCLHNATCADF
VGGYECICLPGFTGTRCETDIDECASSPCKNGATCIDQPGNYFCQCMAPFKGNEHQGKSL
NDTCLQMCCNTGHSIMGTANYKTALLLFFSGLNCEFRPCEASNPCENGAVCTEEMNLDAF
PLGFQCQCVKGFAGPRCEINVNECSSNPCLHGYCYDIVNGFYCLCNPGYAGLTCEQDIDD
CINNACEHNSTCVDLHLRYQCVCLPGWEGTFCEYESNECDSEPCRNNGTCTDLFNSYRHL
CPMGISDVGIEENTNKIRKGKARNGTTCTVYQNSYKCLCTAGWTGPDCSEDINECDSEPC
LNGATCYESVKQGQFVCICPPFYTGDFCHQRFSPCELPYNPCINNSTCLAQADGNPMCIC
KTGYEGTYCEVNSDECISHPCQNEGLCVDGINSYRCFCQHGFTGTLCEVEINECLSRPCK
NNGTCLDLINRFICNCAPGYYGSLCEIDINECETLPCLNGGSCINRLGGYQCFCSPGFTG
ITCQQNLGDRCETNTDECISTPCLNNGSCIDDINSYKCHCRSGFIGTNCETNVNECWPEP
CLHGRCIDLIDGYQCSCEAGWTSSRCEININECESVPCINGGSCQDLVNEFACICLTGYT
GKFCEFDIDICNEPTVSSVLCHNGGVCVDGPGRTFHCSLSS
Download sequence
Identical sequences ENSGALP00000026026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]