SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000026101 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000026101
Domain Number 1 Region: 28-96
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.0069
Further Details:      
 
Domain Number 2 Region: 92-163
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000439
Family VWC domain 0.062
Further Details:      
 
Domain Number 3 Region: 190-235
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000249
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000026101   Gene: ENSGALG00000016220   Transcript: ENSGALT00000026149
Sequence length 343
Comment pep:known chromosome:Galgal4:2:141532750:141540007:1 gene:ENSGALG00000016220 transcript:ENSGALT00000026149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIAQTSTTMTPTIPAAKEAYTRTQYCKWPCECPKSPPRCSIGVSLVTDGCDCCKMCAKQR
GENCTEADTCDFHRGLYCDYSGDRPRYEIGVCSQIVGVGCVLNGVRYNNGDTFQPNCKYN
CTCINGAVGCIPMCTNSRPPLVWCPNPKLIKMAGKCCEQWVCDDSKKIRKTSPRHISSAA
YEGEDEAWQKNCIVHTSPWSPCSKTCGLGISTRISNDNDQCRLLKESRLCNMRPCEVDIT
KHIKPGKKCLAVYRTNEPMNYTISGCMSKSPYRPKYCGICTDNRCCTPYKSKTIEVRFEC
PDGTEISWKIMWINACFCNLNCKNPNDIFADLAHYHDYSEIAN
Download sequence
Identical sequences ENSGALP00000026101 ENSGALP00000026101 9031.ENSGALP00000026101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]