SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000026210 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000026210
Domain Number 1 Region: 38-262
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-72
Family Nuclear receptor ligand-binding domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000026210   Gene: ENSGALG00000016287   Transcript: ENSGALT00000026260
Sequence length 263
Comment pep:known chromosome:Galgal4:1:115358588:115360622:1 gene:ENSGALG00000016287 transcript:ENSGALT00000026260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACLERCHCCADGRRHGSILYSILKSHDQAAEGPGPRRGQAGRGCSCGSQRRVALKSPQV
VCKAASAVLVKTLRFVQNVPCFQELPLDEQLVLVRSCWAPLLVLGLAQERVHLETVESAE
PSMLQRILTTRRLGEHAPAPGRQHPPSAGEIQAIKGFLAKCWSLDISTKEYAYLKGTVLF
NPDLPGLQCTQYIEGLQKEAQEALNEHVRLIHRGDQARFAKLNVVLSLLQSINANVIAEL
FFRPIIGSVNMDDMLLEMLCAKL
Download sequence
Identical sequences F1NRP9
ENSGALP00000026210 ENSGALP00000040848 ENSGALP00000026210 XP_015157780.1.86415 9031.ENSGALP00000026210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]