SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000026309 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000026309
Domain Number 1 Region: 731-846
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-33
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 2 Region: 1775-1895
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-33
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 3 Region: 1431-1537
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-33
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 4 Region: 568-672
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-33
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 5 Region: 1954-2062
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-32
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 6 Region: 188-290
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-31
Family Spermadhesin, CUB domain 0.00095
Further Details:      
 
Domain Number 7 Region: 11-119
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-31
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 8 Region: 1250-1371
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-30
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 9 Region: 2120-2238
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-29
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 10 Region: 2306-2409
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.09e-28
Family Spermadhesin, CUB domain 0.00088
Further Details:      
 
Domain Number 11 Region: 391-501
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.09e-27
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 12 Region: 910-1019
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-27
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 13 Region: 1083-1192
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 14 Region: 1598-1713
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-22
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 15 Region: 2659-2727
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.44e-20
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 16 Region: 2899-2967
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1e-18
Family Complement control module/SCR domain 0.0006
Further Details:      
 
Domain Number 17 Region: 2716-2785
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.97e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 18 Region: 2956-3026
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.76e-17
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 19 Region: 328-400
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.98e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 20 Region: 3015-3077
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.48e-16
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 21 Region: 3075-3144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.63e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 22 Region: 3133-3190
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 23 Region: 2775-2842
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000306
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 24 Region: 2473-2542
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000032
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 25 Region: 2837-2893
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000862
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 26 Region: 2411-2484
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000216
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 27 Region: 507-571
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 28 Region: 677-745
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000025
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 29 Region: 1370-1434
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 30 Region: 852-912
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 31 Region: 2601-2663
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000005
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 32 Region: 1195-1264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000584
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 33 Region: 1544-1608
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000876
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 34 Region: 3195-3262
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000107
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 35 Region: 2066-2135
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000135
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 36 Region: 1894-1958
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 37 Region: 1720-1783
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000594
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 38 Region: 124-185
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000109
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 39 Region: 1025-1087
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000834
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 40 Region: 2237-2301
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000216
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 41 Region: 2535-2611
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000778
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 42 Region: 3254-3311
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000445
Family Complement control module/SCR domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000026309   Gene: ENSGALG00000016341   Transcript: ENSGALT00000026359
Sequence length 3338
Comment pep:known_by_projection chromosome:Galgal4:3:88949756:89752149:1 gene:ENSGALG00000016341 transcript:ENSGALT00000026359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVLLSSSGQNCGGLVQGPNGTIESPGFPHGYPNYANCTWIIITGERNRIQLSFHTFALE
EDFDILSIYDGQPQQGNLKVRLSGFQLPSSIVSTGSILTLCFTTDFAVSAQGFKAIYEVL
PSHTCGNPGEIPKGVLHGTRFNIGDKIRYSCISGYILEGHAMLTCIVSPGNGASWDFPVP
FCRAEGACGGTLRGTSGTISSPHFPSEYENNADCTWTILAEPGDTIALIFTDFQLEEGYD
FLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSR
GVKMLPSKDSNHKNSVLTQGGDAVASDTCPDPGIPENGKRVGSDFRVGASVQFSCEDNYV
LQGSKSITCQRVTDTLAAWSDHRPICRARTCGSNLRGPSGIITSPNYPVQYEDNAHCVWV
ITTVDPEKVIKLAFEEFELERGYDTLTVGDAGKVGDTRTVLYVLTGSSVPDLIVSMSNQM
WLHLQSDDSIGSPGFKAVYQEIEKGGCGDPGIPSYGKRTGSSFLHGDTLTFECQAAFELV
GERMITCQQNNQWSGNKPSCVFSCFFNFTTPSGIILSPNYPEEYGNNMNCVWLIISEPGS
RIHLIFNDFDVEPQFDYLTVKDDGISDLPPLGTFSGNEVPSQLASSGHIVRLEFQSDHST
TGRGFNITYTTFGQNECHDPGIPVNGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCIM
QDGNVVWSSAVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLNCEWVIEARPGHSIKITF
DRFQTEVNYDTLEVRDGPANSSPLIGEYHGTQAPQFLISTGNYMYLLFTTDNSRSSVGFL
IHYESVTLESDSCLDPGIPVNGHRHGNNFNIRSTVTFSCDPGYTLSDEEPLVCERNHQWN
HALPSCDALCGGYIHGRSGTILSPGFPDFYPNSLNCTWTIEVSHGKGVQLLFHTFHLESS
HDYLLITEDGSFTEPVARLTGSVLPPTVKAGLFGNFTAQLRFISDFSISYEGFNITFSEY
DLEPCDDPGVPAFSRRIGFQFGVGDSLIFSCFPGYRLEGANKLTCLGGGRRVWSAPLPRC
VAECGATVSGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRARSFQLHEGDIIKVY
DGKDSSSRSLGAFTKNEMVGVILNSTSNHLWIEFNTNGSDTDQGFQLTYTSFDLVKCEDP
GIPNYGYKIRDEGHFIDTVILYSCNPGYTMHGSGIMTCLSGDRRVWDKPLPTCIAECGGR
IHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTEVAHDILKVWDGPIE
SSILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIASTCNDPGTPQNG
TRYGDSREPGDTTTFQCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAG
VILSPNYPQPYPPGKECDWRIKVNPDFVIALIFKSFNMEPSYDFLHVYEGEDSNSPLIGS
FQGSQAPERIESSGNSLFLAFRSDASVGMSGFAIDYKEKPREACFDPGNIMNGTRIGTDF
KLGSTITYQCDSGYKIIDPSTITCVIGTDGKPAWNRALPSCNAPCGGQYTGSEGVVLSPS
YPHNYTAGQTCHYSITVPKEFVVFGQFAYFQTALNDVAELFDGDNSQARLLSSLSGSHSG
ETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAG
SVVRFECSPGYLLQGSKAIRCHSVPNALAQWNDTVPSCVVPCSGNFTERRGTILSPGYPE
PYGNSLNCVWKIIVTEGSGIQIQVISFATEHNWDSLEIYDGGDMTAPRLGSFSGTTVPAL
LNSTSNQLYLHFHSDISVAAAGFHLEYKTVGLAACPEPVIPSNGIKSGDRYMVNDVLSFQ
CEPGYTLQGRSHISCMPGTVRRWNYPSPLCIAKCGGTLTNMGGVILSPGFPGNYPSNLDC
TWKILLPIGYGAHIQFLNFSTEANHDFLEIQNGPYHTSSMIGQFSGMELPSPLLSTTHET
LVHFYSDHSENRQGFKLTYQAYELQNCPDPPPFLNGYIVNSDYSVGQSVSFECYPGYVLR
GQPVLTCQHGINRNWNYRFPRCEAPCGYNVSAQNGTVYSPGFPDEYPNSKDCTWLIVVPP
GHGIYINFTLLQTEPVNDYIAVWDGPDHNSPQLGVFSGNTALETAYSSTNQVLLKFHSDF
STGGFFVLNFHAYQLKKCQPPPIVPHADLFTEDDDFGIGDFVKYKCHPGFTLVGQDILTC
KLNTQLQFEGSSPICEAQCPANEIRTESSGVILSPGYPGTYPNSQTCSWTIKVDPGYNIS
IFVEMFQSEKQFDELEVFDGSSGQSPLLVALSGNHTGQLNFTSKMNQLYLRWSTDHATSK
KGFKIRYSAPYCSLNPTLRNGGIVNKTGGPAGSKVHYYCKPGYRMIGQNNATCRRHQNGM
YQWDSPVPICRAVSCGIPDSPGNGSVIGNEFTLGSRLIYECNEGFKLESSQQATAVCQED
GLWSNKGRPPVCKSVTCPNIETLLSEHVVWRLVSGSLNEYGAQVMLSCSPGYYLLGRRLI
QCRTNGTWSVGNERPICKVISCGGLPSPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVR
ECLANGLWSGAETQCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRIC
LQDHRWSGQTPVCVPITCGHPGNPAHGMTNGSEFNLNDVVNFTCNTGYLLQGASRAQCRS
NGQWSNPLPNCRVVNCSDPGFVENAIRHGQQNYPESFKYGTSVAYHCKKGFYLLGSSALT
CKSNGLWDRSLPKCLSISCGHPGVPANAVLSGDKFTYGSIIHYSCTAGRRLIGNSTRECQ
EDSHWSGTLPHCSGNNPGYCDDPGIPAHGSRLGDEFKIKSLLRFSCEMGYQLRGSSERTC
LLNGSWSGIQPVCEAVSCGNPGTPANGMIIYSDGILFSSSVIYACWEGYKTSGLTTRHCT
ANGTWTGTAPDCTVISCGDPGALANGIQFGNDFTFNKTVSYQCNPGYVMEPASSSTMRCI
KDSTWNQSKPICKAITCGPPPPVLYGKVEGSDYHWGASVSYSCAEGYQLSNTAILSCEGR
GIWRGDIPQCLPVFCGDPGTPAEGRLNGKSFTYRSEVSFQCRPPFILIGSSRRFCQADGT
WSGIQPTCIDPAHNTCTDPGTPHFGMQNSSRGYEVGSTVFFRCRKGYHIQGSTTRSCLAN
LTWSGIQSECIPHACRQPETPAHVDVKAIDLPTLGYTLVYTCQPGFFLAGGSEHRTCKPD
MKWTGKSPICKSKGVREVNETITKTPGLYTRRVLDLNK
Download sequence
Identical sequences ENSGALP00000026309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]