SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000026355 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000026355
Domain Number 1 Region: 146-733
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 2.59e-195
Family Myeloperoxidase-like 0.0000000000419
Further Details:      
 
Domain Number 2 Region: 739-795
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000236
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 3 Region: 792-839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000268
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000026355   Gene: ENSGALG00000016370   Transcript: ENSGALT00000026405
Sequence length 847
Comment pep:known chromosome:Galgal4:3:92347969:92387125:1 gene:ENSGALG00000016370 transcript:ENSGALT00000026405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVFIVLGISAAIAFTAVFFSFLQTGKDVLFEASEDNCITEAIQKAVNLVDYATQYALYR
NIQDKGIASPTSLLAFSKFPEQDSQDISQAAERMEMSIQVLKQRVCQKYKRSLHPTDLLS
ADLLTMIANISGCLPYMLPPKCPNNCLANKYRLITGACNNREHTRWGASNTALARWLPPA
YEDGLSQPRGWDPSVRYDGVLLPLVREVTRKIINASNEAVTEDNLYSDIIMVWGQYIDHD
ISFTPQSISRTSFLTGKECQMTCERQNPCFPIKVTTNDALSKGMDCLPFYRSSPACGTGD
HSILFGNLSALNPRQQINGLTSFIDASTVYGSTSTVENKLRNLTSEEGLLRVNSKHNDNG
QEYLPFTDRVPSPCAQDSNASEDERIECFMAGDSRSSEVTSLTAMHTLWLREHNRLARAL
KAINSHWSAETVYQEARKIVGALHQIITLRDYIPKIIGPDAFNQYIGLYKGYDPTVNPTV
SNVFATAAFRFGHATIQPIVRRLNAQYLDDPELPNLHLHEVFFSPWRLIKEGGLDPLIRG
LLAHPAKLQVQGQLMNEELTDKLFVLSNNGSLDLASLNLQRGRDHGLPGYNDWREFCDLP
RLETQTDLNTIITNQKVTEKIMELYHIPSNIDVWLGGLVEDFLPGARTGPLFACLIGKQM
KALRDGDRFWWENDNVFTDAQKHELKKHSLSRVICDNTGISDVPIDAFQLGKFPQDFKHC
SNIDGMNLEAWQETFQEEEMCGTPKHVENGNFVYCSEFGESTVTYSCQHGFLLQGEEQLI
CTNKGWNFQAPVCIDINECEKEINPPCSPTAKCINTKGSYKCFCTEPYKLAEDGRTCIDS
IREPAVH
Download sequence
Identical sequences ENSGALP00000026355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]