SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000026419 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000026419
Domain Number 1 Region: 1005-1221
Classification Level Classification E-value
Superfamily vWA-like 9.05e-62
Family Integrin A (or I) domain 0.00013
Further Details:      
 
Domain Number 2 Region: 142-337
Classification Level Classification E-value
Superfamily vWA-like 3.71e-59
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1239-1444
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.01e-32
Family Laminin G-like module 0.069
Further Details:      
 
Domain Number 4 Region: 536-696
Classification Level Classification E-value
Superfamily Fibronectin type III 1.54e-22
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 5 Region: 354-440
Classification Level Classification E-value
Superfamily Fibronectin type III 4.38e-18
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 6 Region: 833-921
Classification Level Classification E-value
Superfamily Fibronectin type III 4.81e-18
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 7 Region: 30-115
Classification Level Classification E-value
Superfamily Fibronectin type III 1.48e-16
Family Fibronectin type III 0.00093
Further Details:      
 
Domain Number 8 Region: 446-532
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000292
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 9 Region: 745-830
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000377
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 10 Region: 926-1009
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000537
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000026419   Gene: ENSGALG00000016411   Transcript: ENSGALT00000026469
Sequence length 1857
Comment pep:known chromosome:Galgal4:2:136374253:136490384:1 gene:ENSGALG00000016411 transcript:ENSGALT00000026469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCWNEVQSCFLLAFLAVAAYSVSDAQGQVSPPTRLRYNVVNPDSVQISWKAPKGQFSGY
KLLVTPSSGGKTNQLILQNTATKAIIQGLIPDQNYALQIIAFSDDKESKPAQGQFRIKDI
ERRKETSKSKVKDPEKTNASKPTPEGNLFTCKTPAIADIVILVDGSWSIGRFNFRLVRLF
LENLVSAFNVGSEKTRVGLAQYSGDPRIEWHLNAYGTKDAVLDAVRNLPYKGGNTLTGLA
LTYILENSFKPEAGARPGVSKIGILITDGKSQDDVIPPAKNLRDAGIELFAIGVKNADIN
ELKEIASEPDSTHVYNVADFNFMNSIVEGLTRTVCSRVEEQEKEIKGTIAASLGAPTDLV
TSDITARGFRVSWTHSPGKVEKYRVVYYPTRGGQPEEVVVDGSSSTAVLKNLMSLTEYQI
AVFAIYSNAASEGLRGTETTLALPMASDLKLYDVSHSSMRAKWNGVAGATGYMILYAPLT
EGLAADEKEIKIGEASTELELDGLLPNTEYTVTVYAMFGEEASDPLTGQETTLPLSPPSN
LKFSDVGHNRAKLTWDPASKNVKGYRIMYVKTDGTETNEVEVGPVSTHTLKSLTALTEYT
VAIFSLYDEGQSEPLTGSFTTRKVPPPQHLEVDEASTDSFRVSWKPTSSDIAFYRLAWIP
LDGGESEEVVLSGDADSYVIEGLLPNTEYEVSLLAVFDDETESEVVAVLGATIVGTTAIP
TTVTTTTTTTATTPKPTIAVFRTGVRNLVIDDETTSSLRVVWDISDHNAQQFRVTYLTAK
GDRAEEAIMVPGRQNTLLLQPLLPDTEYKVTITPIYADGEGVSVSAPGKTLPLSAPRNLR
VSDEWYNRLRISWDAPPSPTMGYRIVYKSINVPGPALETFVGDDINTILILNLFSGTEYS
VKVFASYSTGFSDALTGVAKTLYLGVTNLDTYQVRMTSLCAQWQLHRHATAYRVVIESLV
DGKKQEVNLGGGVPRHCFFELMPGTEYKISVHAQLQEIEGPAVSIMETTLPFPTQPPTSP
STTPPPPTIPPAKEVCKAAKADLVFLVDGSWSIGDDNFNKIISFLYSTVGALDKIGPDGT
QVAIIQFSDDPRTEFKLNAYKTKETLLEAIQQIAYKGGNTKTGKAIKHAREVLFTGEAGM
RKGIPKVLVVITDGRSQDDVNKVSREMQLDGFSFFAIGVADADYSELVNIGSKPSERHVF
FVDDFDAFTKIEDELITFVCETASATCPLVFKDGDNFAGFKMMEMFGLVEKEFSAIDGVS
MEPGTFNVYPCYRLHKDALVSQPTKYLHPEGLPSDYTITFLFRILPDTPQEPFALWEILN
EQYEPLVGVILDNGGKTLTFFNYDYKGDFQTVTFEGPEIRKIFYGSFHKLHVVISKTTAK
IIIDCKEAGEKTINAAGNISSDGIEVLGRMVRSRGPRDNSAPLQLQMFDIVCATSWANRD
KCCELPGLRDEENCPALPHACSCSEANKGPLGPPGPPGGPGVRGAKGHRGDPGPKGPDGP
RGEIGVPGPQGPPGPQGPSGLSIQGLPGPPGEKGEKGDLGFPGLQGVPGASGSPGRDGAQ
GQRGLPGKDGPTGPQGPPGPVGIPGAPGVPGITGSQGPQGDVGAPGAPGPKGERGERGDL
QSQAMVRAVARQVCEQLIQGHMARYNSILNQIPSQSVSTRTIAGPPGEPGRPGAPGPQGE
QGSPGMQGFPGNPGQPGRPGERGLPGEKGDRGNPGVGTQGPRGPPGSTGPPGESRTGSPG
PPGSPGPRGPAGHTGPPGSQGPAGPPGYCDPSSCAGYGMGGGYGEPTDQDIPVVQLPHNS
YQIYDPEDLYDEFTPVREEMEAVELRSPGISRFRRKIAKRSIKTLEHKRENAKEPSQ
Download sequence
Identical sequences ENSGALP00000026419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]