SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000026451 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000026451
Domain Number 1 Region: 151-519
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 8.83e-93
Family Phosphonoacetate hydrolase 0.017
Further Details:      
 
Domain Number 2 Region: 591-857
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.59e-35
Family DNA/RNA non-specific endonuclease 0.0077
Further Details:      
 
Domain Number 3 Region: 57-103
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000222
Family Somatomedin B domain 0.002
Further Details:      
 
Domain Number 4 Region: 105-146
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000209
Family Somatomedin B domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000026451   Gene: ENSGALG00000016428   Transcript: ENSGALT00000026501
Sequence length 859
Comment pep:known chromosome:Galgal4:2:136108200:136163574:-1 gene:ENSGALG00000016428 transcript:ENSGALT00000026501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKGCFYFHQVISLFAFAFGVNVCMGFTTNRFRRSEEWDEGPISVLSDSPWISTSGSCK
NRCFELQEAEPPGCRCDNLCKSYNSCCFDFDELCLKTARGWECTKDRCGETRNDDNACHC
SEDCLSRGDCCTNYQVVCKGETHWVDDDCEEIKTPECPAGFVRPPLIIFSVDGFRASYMK
KGNKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA
SFSLRGREKFNHRWWGGQPIWITAAKQGVKAGTFFWSVVIPHERRILTILQWLTLPDNER
PYVYAFYSEQPDAAGHRYGPFNSEMMVNPLREIDKTVGQLMDGLKQLKLHRCVNVIFVGD
HGMEDTTCERTEFLSNYLTNVEDIILLPGSLGRIRPRSSNNLKYDPKVIVANLTCRKPDQ
HFKPYLKHHLPKRLHYAYNRRIEDVHLLVERKWHVARKAVDVYKKPTGKCFFHGDHGYDN
KINSMQTVFIGYGPTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRANV
YKPTVPDEVAKPLYPVALPSASDFDIGCTCDDKNKLDELNKRFHVKGTEEKHLLYGRPAV
LYRTKYNILHHHDFESGYSETFLMPLWTSYTISKQAEVSGVPEHLASCVRPDLRISPGNS
QSCSAYRGDKQLSYSFLFPPQLSSSAEAKYDAFLITNIIPMYPAFKKVWNYFQRVLVKRY
ATERNGVNVISGPIFDYDYDGLHDTPEKIKQFVEGSAIPVPTHYYAIITSCLDFTQPADK
CDGPLSVLSYILPHRPDNDESCNSMEDESKWVEDLLKMHTARVRDIEQLTSLDFFRKTSR
SYTEILSLKTYLHTFESEI
Download sequence
Identical sequences A0A1D5PQ63
ENSGALP00000026451 NP_001185591.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]