SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gallus gallus 76_4 > ENSGALP00000026599

Domain assignment for ENSGALP00000026599 from Gallus gallus 76_4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSGALP00000026599
Domain Number 1	Region: 390-440
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	3.03e-17
Family	Classic zinc finger, C2H2	0.0077
Further Details:

Domain Number 2	Region: 179-230
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	2e-16
Family	Classic zinc finger, C2H2	0.014
Further Details:

Domain Number 3	Region: 140-190
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.000000000000193
Family	Classic zinc finger, C2H2	0.01
Further Details:

Domain Number 4	Region: 432-484
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.000000000000233
Family	Classic zinc finger, C2H2	0.011
Further Details:

Domain Number 5	Region: 348-400
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.000000000000493
Family	Classic zinc finger, C2H2	0.0091
Further Details:

Weak hits

Sequence:	ENSGALP00000026599
Domain Number -	Region: 223-246
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.0339
Family	Classic zinc finger, C2H2	0.016
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGALP00000026599 Gene: ENSGALG00000016516 Transcript: ENSGALT00000026650
Sequence length	511
Comment	pep:known_by_projection chromosome:Galgal4:3:104109217:104113430:1 gene:ENSGALG00000016516 transcript:ENSGALT00000026650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MPRRKQSHPQPVKGECAAGPVGHNTGMDGGGLRLTVARLCCVPLPFCPEQQPVDAPKGSR CPRSEALVGKIAIPAYALSDDDCSSGYQQLSVDSDPEEGGEPGPAALPCRQCGLQLAASL GQSCLQCAGTEGGRNQRIVYTCQLCPFASHYSSHLKRHMKTHNGEKPFACPQCAYASAQL VNLTRHLRTHTGEKPYRCTGCSFACSSLGNLKRHERVHSQDKPFQCAACDYRCNQSRNLK RHMLSHRLPEGEGQHQQDKDPEPLLPELNLHMGSGSGPFLPGCARLRGEETAALPELLFP FTCRMCGLVLDDGFAQDEGLAEQVCGRCSLAVLGTEPGASPRKGTGDKGFACSLCPFVTH YPNHLARHMKTHSGEKPFACPLCPYASAHLDNLKRHQRVHTGEKPYKCQLCDYACGNLAN LKRHGRIHSGDKPFQCSLCSYSCNQSMNLKRHMLRHTGEKPFQCRDCTYTTGHWDNYKRH QKIHGHTAENWVNPRNAKALLAPPAVDTALP
Download sequence
Identical sequences	ENSGALP00000026599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]