SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000026614 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000026614
Domain Number 1 Region: 62-219
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.77e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000026614   Gene: ENSGALG00000016523   Transcript: ENSGALT00000026665
Sequence length 224
Comment pep:known chromosome:Galgal4:1:119914133:119926065:1 gene:ENSGALG00000016523 transcript:ENSGALT00000026665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFKMGRVLLSLLFWYKAVLALSPGEDERLELWHSKACKCNCQGGPNSVWSSGTNSLECM
PECPYHKPLGFESGAVTPDQISCSNPEQYTGWYSSWTANKARLNGQGFGCAWLSKYQDNG
QWLQIDLKEVKVISGILTQGRCDADEWMTKYSVQYRTDENLNWVYYKDQTGNNRVFYGNS
DRSSSVQNLLRPPIVARYIRLIPLGWHVRIAIRMELLECLGKCG
Download sequence
Identical sequences F1NI48
ENSGALP00000026614 NP_001128447.2.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]