SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000026719 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000026719
Domain Number 1 Region: 394-539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-24
Family MAM domain 0.0023
Further Details:      
 
Domain Number 2 Region: 165-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000139
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 3 Region: 91-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000754
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 4 Region: 138-257
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000424
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000026719   Gene: ENSGALG00000016584   Transcript: ENSGALT00000026770
Sequence length 543
Comment pep:known chromosome:Galgal4:1:122466941:122507987:-1 gene:ENSGALG00000016584 transcript:ENSGALT00000026770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPAPGGALLAAFLAAALAAAGSSRARGQLVTVSQPGVCRYGSRLDCCYGWKKNNKGRCE
AICGHGCKYGECMGPNKCKCYPGFTGKTCNQDLNECGLKPRPCEHRCMNTHGSYKCYCLN
GYMLMPDGTCASSRTCAIANCQYGCEEVKEEVQCLCPSVGLHLGPNGRTCIDIDECSTGR
AVCSFNRRCVNTFGSYYCKCQLGYELKYISGHYDCVDVNECVTTAHRCNLHAECLNTEGS
FKCKCNQGYQGNGFDCAAIPEKSVKEIPRIPGTAKDTIKKLLAHKNSVTKHKAIKNVIPE
AAMTPASKTRLQSLDYEGGFDLGGSYTVGEKKTEVTIEEEVDETDEEEKEDYENQVDHEQ
SLRGDVFFPQGKEAAAFGPLLAQRKVSVTRQEHEVDCSFSRGVCDWKQDTSDDFDWNPAD
RDRGDGYYMAVPAFVGQKKDMGRLKLLLSDLKPKSTYCLIFSYRLAGERVGKLRVFMANK
KTAPVWEQDKGKDERWRTGKVEILQGAETTNSITFESERGKGKTGEIGVDNVILVPGLCP
EDT
Download sequence
Identical sequences E1BRR0
ENSGALP00000026719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]