SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000026967 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000026967
Domain Number 1 Region: 3954-4327
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.92e-100
Family Regulator of chromosome condensation RCC1 0.0012
Further Details:      
 
Domain Number 2 Region: 4464-4795
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.63e-89
Family Hect, E3 ligase catalytic domain 0.0000427
Further Details:      
 
Domain Number 3 Region: 419-779
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.72e-89
Family Regulator of chromosome condensation RCC1 0.0094
Further Details:      
 
Domain Number 4 Region: 2964-3256
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.05e-61
Family Regulator of chromosome condensation RCC1 0.0017
Further Details:      
 
Domain Number 5 Region: 2733-2915
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.21e-32
Family APC10-like 0.0078
Further Details:      
 
Domain Number 6 Region: 2558-2635
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.08e-29
Family CPH domain 0.00058
Further Details:      
 
Domain Number 7 Region: 3206-3329
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.36e-28
Family Regulator of chromosome condensation RCC1 0.046
Further Details:      
 
Domain Number 8 Region: 1865-1932
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 7.45e-22
Family Mib/herc2 domain 0.00013
Further Details:      
 
Domain Number 9 Region: 1207-1290
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000000000288
Family Cytochrome b5 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000026967
Domain Number - Region: 2453-2509
Classification Level Classification E-value
Superfamily UBA-like 0.000149
Family UBA domain 0.0093
Further Details:      
 
Domain Number - Region: 3622-3712
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0178
Family Spermadhesin, CUB domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000026967   Gene: ENSGALG00000016739   Transcript: ENSGALT00000027018
Sequence length 4841
Comment pep:known chromosome:Galgal4:1:129860463:129965042:1 gene:ENSGALG00000016739 transcript:ENSGALT00000027018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSESFCLAAQARFDSKWLKTDLQLAFTRDGLCGLWNEMVKDGEIVYPGTEFTQNGELPP
RKDDSTECQTASKKEEQNDKEKKDEEEAPPPTYRARSIVESWVWGKQPDVNELKECLHVL
VKEQQTLATQTATTALSAMRLKQRLVILERYFIALNRTVLQENVKVKWKSNSVPLPTVDK
KSPRPVGKGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEAS
LFDEGTVSSVWLEVVERATKFLRSVVTGDVHGAPSTKGPGNIPLQDQHLALAILLELAVQ
RGTLSQMLSAVMLLLQLWDNGTRETDNERSAQGTSAPLLPLLQRFQSIVCNKDMPNSEEE
IQLLTYPLSPNESFLRYLTLPQDNELAIDLRQTAVVIMAHLDRLATPCMPPQCSSPTSHK
GSLQEVIAWGLIGWKYYANVSGPIQCEGLANLGVVQIACAEKRFLILSRNGRVYTQAYNS
DTLGPQLVQSLASRNIVKIAAHSDGHHYLALSANGEVFSWGCGDGGRLGHGDTVPLEEPK
LISALSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDQTIPMLVTG
LKGLKVIDVSCGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDI
VKVRCGSQFSIALTKDGQVYTWGKGDNQRLGHGTEEHVRYPKLLEGLKGKKVIDVAAGST
HCLALTEDSEVHSWGSNDQCQHFDTLRITKPEPAALPGLDTKHIVGIACGPAQSFAWSSC
SEWSIGLRVPFVVDVCPMTFEQLDLLLRQVTEGMDGSSDWPPPQEKECMAVATLNLLRLQ
LHAAISHQVDPECLGLGLGGILLNSLKQTVVTLASNAGVLNTVQSAAQAVLQSGWSVLLP
TAEERARALSALLPSAVSGNEMNVSPGRRFMIDLLVGSLMADGGLESALNAAITAEIQDI
EAKKEAQKEKEIDEQEANASTLHRSRTPLDKDLINTGIYESAGKQSLPLVQLIQQLLRNI
ASQTIAKLKDVARRISSCMDHEHFSKERSASLDLLLRFQRLLVSKLYPGDCVGQVPNTYS
PDQLGVGSLLKKYTALLCTHISDILPVATSIASTSHRHFAEVSYVVDGDLTGILLPELVV
SIVLLLSKNAGLMQEAGAIPLLAGLLEHLDRFNHLAPGKERDDNEDLAWPGIMGSFFTGQ
SCRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGEDPVV
ALEAALQFEDTRESMHAFCVGQYMEPDQEVISTPDLSTLSSPLIDTERNLGLLLGLHASY
LAMSTPLSPLEVECAKWLKSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGNTTPNKSKLYS
HRLTLSDHSQPFLQAIADNNIQDHTVKDFLCQIERYCKQCHLTTPITFPPEHPVEEVGRL
LLCCLLKHEDLGHVALSLVHPGTLGVDQVKHKTLPKSVVDVCRVVYQAKCSLIKTHQEQG
RSYKEVCAPVIERLRFLFNELRPAVCNDLSIMSKFKLLSSLPRWRRVVQKIIREKRKKRV
PKKSESADVEESKIGNEGSDLEESCVVPHSPVPIDKRPIPIKSPKDKWQPLLSTVTGVHK
YKWLKQNVQGLYPQSALLNTIVEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKL
AAKNFLLPSVQYAMFCGWQRLIPEGANIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYAW
AVQNVRNILLDATAKFKELGVQPVPLQTITNENPAGPSLGTIPQARFLLVMLNMLTLQHG
ANTLSLLLNSGMLALTQTTLRLIGPSSDNIEEDMIASSHGASATVLEESRKETTPVQLPV
SGPELAAMMKIGTRVVRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRM
GKEGKYDLKLAEPPPAAQPTTEDSDTEDDSEGEQVERNLHPTSMMLTSTVNLLQTLCLSA
GVHAEVMQSDATRTLCGLLRMLVESGTIDKSASLPNKLVYKEQHRSWCTLGFIRSIALMP
QMCSTLSTSQWITLLMKIVEGHESFTAASLQRQILAVHLLKAVLPSWDKNERSRDMKFLV
EKLFGFLGSLLSTCSSDIPLLRESTLRRRKARPQASLTATHSSTLAEEIVALLRTLHSLS
QWNGLINKYINSQLTSITHIFAGKQSEGAVLDDYFPDTENPEVGGLMAVLAVIGGIDSRL
RLGGQVVHDEFGEGTVTRITPKGKITVQFYDMRTCRVCPLNQLKPLPVVAFNVNNLPFTE
PMLSIWAQLVNLAGSKIEKHRMKSPNQGLSGQVDLDLLRCQQLKLYILKAGRALLSHQDT
LRQILSQPAVQESSLNAGDDGAVASPDIGDMSPEGPQPPMILLQQLLTAATQPSPVKAIF
DKQELEAAALAVCQYLAVESTHPSTPVFEDCSSSEATTPVTVQHIRPTKVKKRKQSPIPP
LPIVVQLMEMGFPRKNIEFALKSLSGTSGSASGLPGVEALVGWLLDHPDVQITDLSDADT
VSDEYSDEEITEEVEEAEAACPVSSGAVVTESQTYKKRADFLSNDDYAVYVRENIQVGMM
VRCCRTYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELLGFPPQSSA
SHIKIGDKVRVKTSVTTPKYKWGSVTHRSVGVVKAFSANGKDVIVDFPQQSHWTGLLSEM
ELVPSIHPGVTCDGCQMFPINGPRFKCRNCDDFDFCETCFKTRKHNTRHTFGRINEPGQS
PVFCGRSGKQLKRRHSSQRGMLLDDWSRIVKNLNVSSSVNQASRLIDGSEQCWQSSGSQG
KHWIRLEIFPDVLVHRLKMVVDPADSSYMPSLVVVSGGSSLNNLIELKTININPTDTTVP
LLSDCTEYHRYIEIAIKQCRSSGIDCKIHGLSILGRIRAEDEDLAAVPFLASDNEEEDDD
KANTGSLVRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQ
VAGGSKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSNYVVKKVAVHSGG
RHAMALTVDGKIFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAAITS
SGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFS
WGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFR
LGHGTDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDTGQVYAWGDNDHGQQGNGTTTV
NRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPS
DADSSAASNKISGANSSKPNRPSLAKILLSLDGNVAKQQALSHILMALQIMYARDAVVGA
LMPASMIAPVECPSSSPAPPSDATSTGSPASGDECMIVGDIEERLSPNPWQDRRGEVVSS
EDAVTPSAVTPSAAAASSRPFIPVTDDPGAASIIAETMTKTKEDVESQSKVSGPEPQYLD
EFTSLLVPDDTRVMVDLLKLAVSNRAGEKGRDVLSAVLSGMGTAYPQVADMLLELCVTEL
EDVATDSQSGRLSSQPVVVESSHPYTDDTSSSGTVKIPGAEGLRVEFDRQCSTERRHDPL
TIMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGP
KDLLSDRCILSCPSMDLVTCLLDFRLNFASNRSIVPRLAASLAACAQLSALAAGHRMWAL
QRLRKLLTTEFGQSININRILGDNDGEARTLSFTGSALAALVKGLPEALQRQFDYEDPIV
RGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPR
LFLDEVAKKIRELMADNENMDVLHECHDVFKREQDEQLVQWMNRRPDDWTLSAGGSGTIY
GWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGG
RLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGN
RSPCDRPRVIESLRGIEVVDIAAGGAHSACITAAGDLFTWGKGRYGRLGHGDSEDQLKPK
LVEALQGYRVIDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLT
DLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIA
TGSLHCVCCTEDGLGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKINRVACGSAHT
LAWSTSKPANAGKLPTQVPMEYNHLQEIPIISLRNRLLLLHHISELFCPCIPMFDLEGRL
DETGQGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGG
LAGPDGTKSVFGQMCAKMSSFSPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEMCEEL
QNGLTPLLIVTPNGRDESGANRDCFLLNPAAKSLLHMNMFRFLGVLLGIAIRTGSPLSLN
LAEPVWKQLAGMNLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPNASGQDI
QLSSKYTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETM
VCGSPDIPLHLLKSVATYKGIEPTASLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTI
ADFRGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDT
DDYARIALTGEPAADDSSDDSDNEDADSFASDSTQDYLTGH
Download sequence
Identical sequences ENSGALP00000026967 ENSGALP00000026967 9031.ENSGALP00000026967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]