SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000027103 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000027103
Domain Number 1 Region: 256-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-40
Family Laminin G-like module 0.0000000219
Further Details:      
 
Domain Number 2 Region: 458-667
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-30
Family Laminin G-like module 0.00000136
Further Details:      
 
Domain Number 3 Region: 47-100
Classification Level Classification E-value
Superfamily GLA-domain 3.7e-17
Family GLA-domain 0.00084
Further Details:      
 
Domain Number 4 Region: 98-231
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000377
Family Growth factor receptor domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000027103
Domain Number - Region: 233-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000661
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000027103   Gene: ENSGALG00000016820   Transcript: ENSGALT00000027154
Sequence length 671
Comment pep:known_by_projection chromosome:Galgal4:1:136509160:136547639:1 gene:ENSGALG00000016820 transcript:ENSGALT00000027154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGSTGAATSQICWVALVSFLPPPGPAVLLRAPEAAQFLRQRQRRAYQIFEETQGHLEREC
VEEHCSKEEAREVFENDPETEYFYPKYLACIHKYGSPYTRSPDFLTCVHNLPNQCSPDPC
YKEGTVRCEDLKGDFYCECKRGWQGKTCDKDIDECKVQHGGCNQICLNKLGSYRCSCYSG
YALKDSKTCEDIDECAASADICGEARCKNLISSYECVCDAGYRYDEQRKTCDDINECEER
LCEQMCVNSPGSYTCHCDGRGGVKLSQDMNTCENIIPCVPFAVAKSVKSLYLGRMFSGTP
VIRLRFKRKQLTRLVAEFDFRTFDPEGILFFAGGHQDSTWVVLALRKGRLELQLKYSGIG
RVTSSGPLINHGMWQTISVEELERSLVVKVNRDAVMRIAVSGDLFTLDKGLYQLNLTVGG
IPFKTKDLIVPINPRLDGCLRAWNWLNGEDSTIQETIKMNERMQCFAVAGRGSFYPGRGF
AIFNLTYMQPSSRNETKTSWKIEVNAVIQPATDTGVMFALVTEDASVPLSLSLVDYHSTK
KLKQQFVILAVEDTVVSRLALNLCDKKEHSVDILLKKDQLSLRVDGMEGERELSTSELED
SLSILESSLQSPVKTYVGGLPDVNVTATPVTAFYHGCMTVKLRSKALDLDEALYKHSDIT
SHSCPPVEAGP
Download sequence
Identical sequences ENSGALP00000027103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]