SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000027123 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000027123
Domain Number 1 Region: 136-406
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.64e-42
Family Eukaryotic proteases 0.00025
Further Details:      
 
Domain Number 2 Region: 41-103
Classification Level Classification E-value
Superfamily GLA-domain 1.06e-22
Family GLA-domain 0.00059
Further Details:      
 
Domain Number 3 Region: 92-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000318
Family EGF-type module 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000027123   Gene: ENSGALG00000016832   Transcript: ENSGALT00000027174
Sequence length 407
Comment pep:known_by_projection chromosome:Galgal4:1:136903332:136910194:-1 gene:ENSGALG00000016832 transcript:ENSGALT00000027174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARCFWTVLFLLSALFLQTEQTVFISTDDANKVIKRHRRANSLHFEEVLQGSLERECLEE
RCTHEEAREVFENDEMLKMFWDNYYDGWRCSSSPCQHGGLCEDSIRDYTCTCTTGFEGKD
CAFAKNECRHQGKEGCQHFCYPGSNSYHCSCADGYELGKDKKQCIPLDQCACGRLKDNNS
LISETPEEHGKQFPWQVLLLNSEGKGFCGGVLLKSNFVLTTAECALLHNHFKIRVGAGHN
RTSGAEKIMEVHEKHIHIRYDEDTGENDIALLQLQEHIECSNHQLPVCIPERDFAEHILI
PKLAGTVIGWNMEGGEFQGDELQVSYLPTEDCEQMLNASLTNRQFCGHSQEAIDKQLAGG
SFMATVYKGTWFLTGILGPWPLEDADRKTFLFTNTARYMIWFKQKMR
Download sequence
Identical sequences E1BT71
9031.ENSGALP00000027123 ENSGALP00000027123 XP_416945.3.86415 ENSGALP00000027123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]