SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000027125 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000027125
Domain Number 1 Region: 150-424
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.32e-87
Family Eukaryotic proteases 0.00000875
Further Details:      
 
Domain Number 2 Region: 40-103
Classification Level Classification E-value
Superfamily GLA-domain 1.28e-23
Family GLA-domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000027125   Gene: ENSGALG00000016833   Transcript: ENSGALT00000027176
Sequence length 425
Comment pep:known chromosome:Galgal4:1:136938052:136946321:-1 gene:ENSGALG00000016833 transcript:ENSGALT00000027176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSRQCVALLLCFPLLVPPSLEAVFLKQEEANSIFQRHRRANSFFEEIKLGSLERECIEE
KCSFEEAREIYRDDERTKEFWHIYSDPNQCDSSPCQNGGSCDDQFQDYVCRCPPEYEGKS
CETAVAENLKCIYDNGGCEQYCADEQSEKRVCFCAEGYALASDGVSCIPQVKYPCGTIPV
LAKKNTTAQGRIVGGVTCPPGECPWQALIIQDQKGKCGGSLLSPEWVVTAAHCLDYAHSK
QLRVRLGEYSVKVAEKTEQESGVSKIIRHEEYTIGQVNHDIALLKLETPVNLTDFVVPIC
LPEKRFAVYELSSIKFSMVSGWGRLLDGGATSTFLMRVHLPRVKTQECEKQANLNITENM
FCAGDLTGKKDSCKGDSGGPHATKYKNTWFLTGIVSWGKGCAVEGSYGVYTRVSRYINWL
KRHME
Download sequence
Identical sequences F1P2T9
ENSGALP00000027125 9031.ENSGALP00000027125 ENSGALP00000027125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]