SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000027146 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000027146
Domain Number 1 Region: 1556-1668
Classification Level Classification E-value
Superfamily C-type lectin-like 3.3e-47
Family Noncollagenous (NC1) domain of collagen IV 0.000000739
Further Details:      
 
Domain Number 2 Region: 1444-1553
Classification Level Classification E-value
Superfamily C-type lectin-like 5.42e-44
Family Noncollagenous (NC1) domain of collagen IV 0.000000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000027146   Gene: ENSGALG00000016841   Transcript: ENSGALT00000027197
Sequence length 1669
Comment pep:known chromosome:Galgal4:1:138136838:138247249:-1 gene:ENSGALG00000016841 transcript:ENSGALT00000027197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRWLGFGLLLSAELSAVSAAGCSGCGKCDCSGVKGQKGERGLPGLQGVIGFPGMQGPEG
PPGPPGLKGDTGEPGLPGTKGTRGPPGPSGFPGNPGLPGIPGQDGPPGPPGIPGCNGTKG
ERGPVGPPGLPGLTGSIGPPGPPGIKGDPGEVIGILPPSVLKGDKGFPGQPGLPGPPGTP
GFQGPMGPPGIPGEPGPPGPPGPPGEKGYMGLGFQGPKGEKGEQGVQGPPGPPGPAPHMK
EKGSEIIKGEKGEPGEKGEQGVPGLPGSGYRGEKGEPGKPGPRGKPGKDGEPGPKGEPGL
PGGFGIPGRPGEPGAKGEKGDQGPQGPPGRIIDAGPIDTFGEKGDPGVSGLPGLKGQKGE
KGFPGAQGIPGIPGRPVPDMVGSPGVPGQRGEKGEKGSPGFPIPGPPGRDGFPGPPGLPG
PPGPPGVTDGIDQCQQGQPGAPGVPGPPGQHGFPGEMGEKGEKGETCALCDKVGPPGLPG
PQGLPGPAGFPGQSGFKGDRGLPGLDGLPGVPGPPGAPGLIGLPGAKGEPGDFTYDSILK
GEKGDPGFPGQPGIPGREGTPGKDGLPGPQGPKGASGTAGLKGERGPPGQPGFPGVRGER
GLPGSPGVGTAGLPGDKGERGFAGTPGLPGLPGTKGEAGRTVPLPGPPGADGLPGPPGFP
GPQGDKGNPGLPGRPGLPGEKGAVGQPGIGFPGPPGPKGFPGQPGSPGPPGTPGTPGLDG
FPGTPGLQGQKGEPGVGLPGPKGLPGIPGPAGIPGEKGNPGLPGLRGEQGFPGVPGQQGF
RGDPGLPGLQGLPGPQGSPGVGPPGLPGPAGQPGPEGPPGFPGIKGERGFPGIPGLDMPG
PKGDKGSQGQPGVPGSVGLPGLPGPQGSVGLKGSAGAKGEMGVMGTPGLPGTPGPVGDRG
LPGEKGSQGLKGVVGPQGEPGVKGDKGEAGLPGIPGSMDTMDMVSLKGQKGDPGEKGDLG
PTGEKGLRGEYGEPGIPGRDGEPGTPGQPGPKGDQGPPGYPGDPGIPGQKGSVGEMGLPG
TPGEKGLPGIPGSPGTPGFPGQKGEKGDKGAAGFPGIGFPGSPGEKGEPGRTGSPGLSGD
KGEKGNAGIPGMPGAPGPKGSPGIAGFPGSPGLHGAKGEKGLPGLSGIPGLKGEPGEPGV
PGPAGSIGQKGEPGYDGIPGTAGAKGEQGVPGRGVPGYPGAKGDKGAKGEVGFPGSPGIP
GIPGLKGEQGYAGPPGPKGNQGLPGLPGSAIEGPKGDRGPQGQPGLPGLPGPTGPPGPPG
LKGAKGEQGSDGWPGTPGGPGDKGDPGFQGLPGSPGLPGGAGEKGDLGPPGVPGVPGPKG
SAGFPGLKGERGDQGLPGSKGLQGPPGPPGAFQLIKGDPGLPGPVGPVGLKGFPGHPGPK
GQQGVTGPSGVPGPPGSPGFDGRPGQKGEVGPYGPPGPRGIPGPPGPEGLPGAMGPPGAA
SVAHGFLVTRHSQTTEEPQCPFGTRLIYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTM
PFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGESIRPFISRCSVCEAPAMVIAV
HSQTIQIPPCPEGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRG
TCNYYANAYSFWLATIERNEMFKKPTPSTLKAGDLRSNVSRCQVCMRNT
Download sequence
Identical sequences 9031.ENSGALP00000027146 ENSGALP00000027146 XP_015133309.1.86415 ENSGALP00000027146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]