SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000027157 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000027157
Domain Number 1 Region: 1602-1714
Classification Level Classification E-value
Superfamily C-type lectin-like 1.06e-43
Family Noncollagenous (NC1) domain of collagen IV 0.00000108
Further Details:      
 
Domain Number 2 Region: 1495-1601
Classification Level Classification E-value
Superfamily C-type lectin-like 5.89e-42
Family Noncollagenous (NC1) domain of collagen IV 0.000000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000027157   Gene: ENSGALG00000016843   Transcript: ENSGALT00000027208
Sequence length 1715
Comment pep:known chromosome:Galgal4:1:138247624:138387983:1 gene:ENSGALG00000016843 transcript:ENSGALT00000027208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSPLPGARVSVCQDVGLLLVLLEVVLSAGRVDAGGKSYTGPCGGRDCSGGCQCFPEKG
ARGQPGILGSQGFPGPPGLMGIPGLQGPKGHKGERGHPGISGPKGETGQRGVTGFPGADG
VPGHPGQPGSRGKPGHDGCNGTVGDPGDPGTPGHSGFPGTIGVQGPKGQKGEPYVLPPDI
ASRHRGDPGDPGFTGFPGAPGTLGIQGPIGPRGVPGRPGPPGSPGPQGPQGNRGLGFYGE
KGEQGSPGPPGPPGLPTRELIGVPTDKHKGERGEPGQKGEAGFPGVLLFAPEKGEEGVMG
FPGQRGLPGNDGFPGLSGERGFPGFDGQPGQYGPRGGKGEQGEMGPPGPPAYVPYRIPRK
GVRGDPGSPGASGLRGEQGEQGDRGLPGIPGFSDGDADKPGLPGEIGPKGEKGEEGSPAY
QAGPPGFPGKHGEPGIRGPPGPPGTPGSLFGLKGQEGTPGRPGVQGFPGPRGQRGPKGEE
GDCSKCLLSDELRRGSTGPRGPPGFPGTPGQPGRKGEPGDQGPHGIPGYAGAKGQSGQEG
LPGPKGEKGDSIYITTKGTKGIRGDPGLPGIRGEDGFPGRDGLDGLPGLPGLPGDGIRGL
PGDPGYPGELGPKGFPGEIGLPGEGYPGPKGYRGLPGDRGTDGHPGPPGLPGPPGEPGQL
DCGQVIEDFSRGEATDPIWSGGGCVRPPKGSQGNPGLPGATGTKGARGFPGDPGPVGFPG
LNGTRGDPGREGYPGPPGFIGPRGDRGPNGLPGLQGHPGLMGKSGAPGLAGQKGAPGDVL
GAAAGPRGDDGLPGFPGLKGAPGDQGIPGIRGADGNPGLPGPKGDPGLQGLPGLMGLPGT
PGTHGFPGPPGNRGPDGGPGSQGPLGPPGARGEDGEQGFPGPVGMKGLSGDKGETGFPGL
QGIPGVTGPPGISGMDGFPGDKGSRGSPGIDGFKGMPGLKGRPGIKGIKGEFGLLGTRGD
KGAQGARGFKGDRGEQGPPGEPPKLKPSMMMEVKGEKGDAGETGTKGFFGIKGSKGMPGL
PGKTGIPGSPGHPSYVPGVKGDIGAKGLTGLKGYPGPTGSPGIRGFPGSTGGRGDKGAPG
ISGHFGTPGSHGEIGEPGDTINLPGMPGLKGEVGVPGLTGLRGGPGQKGEGGDPGLPGIE
GLKGIQGVPGSLGQKGLPGLVGPPGQQGSPGTPGFQGEKGAPGWPGLPGQAGLPGLRGIS
GLHGLPGTKGLPGSPGPDGYGSAGFPGPVGDKGEAGEPSRVEGSQGPPGQKGDRGVPGVQ
GPFGIPGQDGLPGPPGISNISGYPGDTGSPGLDGVPGYPGLHGQPGIPAPPGSKGESGRA
GVSGQAGPKGTRGDPGLPGRPGIPGYPGPKGRKGEQGVIGFIGTVGFPGDLGPIGPKGDR
GLTGFQGPPGSPGLPPIPPRLVAEQGSPGPRGNAGPRGSPGDAGPQGPPGEPGLRGLPGE
PGLQGRGGIPAPPGSRGEQGAMGFQGPVGFEGQPGRPGSPGLPGMPGRSVSIGYLLVKHS
QSDQEPMCPIGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDICY
YANRNDKSYWLSTTAPLPMMPVAEEEIRPYISRCSVCEAPAVAIAVHSQEASIPRCPEGW
RSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGARGTCHYFANKYSFWL
TTIDQPFQSKPSADTLKAGLIRSHISRCQVCMKNL
Download sequence
Identical sequences NP_001155862.1.86415 ENSGALP00000027157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]