SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000027295 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000027295
Domain Number 1 Region: 270-455,663-802
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.35e-59
Family Regulator of chromosome condensation RCC1 0.011
Further Details:      
 
Domain Number 2 Region: 3496-3686
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-26
Family APC10-like 0.01
Further Details:      
 
Domain Number 3 Region: 2003-2046,2127-2170
Classification Level Classification E-value
Superfamily E set domains 0.00000000334
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Domain Number 4 Region: 4235-4297
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000134
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000027295
Domain Number - Region: 3464-3525,3807-3885
Classification Level Classification E-value
Superfamily ARM repeat 0.00494
Family Mo25 protein 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000027295   Gene: ENSGALG00000016915   Transcript: ENSGALT00000027346
Sequence length 4370
Comment pep:known_by_projection chromosome:Galgal4:1:153466828:153648432:1 gene:ENSGALG00000016915 transcript:ENSGALT00000027346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDSTGQSLTALSCACLFSLVAAWGETGRTLQAISAILTNNGSHACQTIQVPTILNSLQR
SVQAVLVGKIQIQDWFSNGIKKAALMHKWPLKEISVDEDDQCLLQSDGFFLYLLCKDGLY
KIGSGYSGTVRGHIYNSTSRIKNRKEKKSWLGYAQGYLLYRDANNHSMTAIRINPETLEQ
DGTVALPDCHTEGQNILFTDGEYVNQIAASRDDGFVVRIFATSTEPVLQQELQLKLARKC
LHACGISLFDLEKDLHIISTGFDEESAVLGAGREFALMKTASGKIYYTGKYQSLGIKQGG
PSAGKWVELPITKSPKIIQFSVGHDGSHALLVADDGSIFFTGSASKGEDGESTKSRRQSK
PYKPKKIIKMEGKIVISTACNNGSSSVISKDGELYMFGKDAIYSDSTSLVTDLKGHFVTQ
VAMGKAHTCVLMKNGEVWTFGVNNKGQCGRDTGSMSQGGKGFGVENMATAMDEDLEEELD
EKDEKSMMCPPGMHKWKLEQCMVCTVCGDCTGYGASCVSSGRPDRVPGGICGCGSGESGC
AVCGCCKACARELDGQEARQRGILDAVKEMIPLDLLLAVPVPGVNIEEHLQLRQEEKRQR
VNRRHRLEEGRGPLVFPGPIFMNHREQALARIRPHPAQLKHKRDKHKDGSGERGEKDASK
ITTYPPGAVRFDCELRAVQVSCGFHHSVILMENGDVYTFGYGQHGQLGHGDVNSRGCPTL
VQALPGPSTQVTAGSNHTAILLMDGQVFTFGSFSKGQLGRPILDMPYWNAKPAPMPNIGS
KYGRKATWIGASGDQTFLRIDEALINSHVLATSEIFASRHIIGLVPASISEPPPFKCLLI
NKVDGSCKTFNDSEQEDLQGSGVCLDPVYDVIWRFRPNARELWSYNAVVADSRLPSAPDM
QSRCSILSPELALPTGSKALTTRSHAALHILGCLDTLAAMQDLKMGIANTEEETQAVMKV
YSKEDYSVVNRFESHGGGWGYSAHSVEAIRFCADTDILLGGLGLFGGRGEYTAKIKLFEL
GPDGGDHETDGDLLAETDVLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCG
SHGQASITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLYRLPTSDGSASKGKQQTSEPVH
ILKRSFARTVSMECFESLLSILHWSWTTLVLGVEELRGLKGFQYTATLLDLERLRFVGTC
CLRLLRVYTCEIYPISATAKAVVEETSKLADCIGKTRTLLRKILSEGVDHCMVKLDNDPQ
GYLSQPLSLLEAVLQECHNTFTACFHSFYPTPSLQWACLCDLLNCLDQDIQEANFKTSSS
RLLAAVMSALCHTSVKLTSIFPIAYDGEALLRSVVKQVSTENDSALAHRFPLLVSHMEKL
SQSEENVSGMTSFREVLEKMLVIVVLPVRNSLRRENELFSSHLVSNTCGLLASIVSELTA
SALGSEVDGLNSLHSVKSTPNRFTKTSQGRSWNTGNGSPDAICFSVDKAGVVVVGFSVYG
GGGIHEYELEVLVDDSDHTGDSTHSHRWTSLELVKGTYTTDDSPSDIAEIRLDKVVPLKE
NVKYAVRLRNYGSRTANGDGGMTTVQCPDGVTFTFSTCSLSSNGTNQTRGQIPQILYYRS
EYDGDLQSQLLNKANEEDKNCSRALSVVSAVVRAAKDLLHRALAVDAEDIPELLSSSSLF
SMLLPLIIAYIGPVAAAIPKVAVEVFGLVQQLLPSVAVLNQKYAPPAFNPNQSTDSTTGN
QPEQGLSACTTSNHYAVVESEHPYKPACVTHYKVTFPECVRWITIEFDTQCGTAQSEDVL
RLLIPVRIAQSLGFGPKHASVHENLNSWIELKKFSGSSGWPTMVLVLPGNEALFSLETAS
DYVKDEKACFYGFKCYAIGYEFSPGSDEGIIQLEKELANLGGSCAAALMKKDLALPIAGN
EFEEDLEILEEAALQVCKSHSGILGKGLALSHSPTILEALEGSLPLQVQSNEQSFLEDFI
ACVPGSSGGRLARWLQPDSYADPQKTSLILNKDDIRCGWPTVITVQTKDQYGDVVHVPNM
KVEVKAIPVSQKKTSLQQEQVKKVQRIPGSPAAAASPCTDMTFGGLPSPKLDSSYEPMIV
KEARYIAITMMKAYENYSFEELRFASPTPKRPSENMLIRVNNDGTYCANWTPGAVGLYTI
HVTIDGIEIDAGLEVKVKDPPKGMIPPGTQLIKPKAEPQPNKVRKFVAKDSAGLRIRSHP
SLQSEQIGIVKVNGSITFIDEIHNDDGVWLRLNDETIKKYVPNMNGYTEAWCLSFNQHLG
KSLLVPVDNVFNASQGVRDLDFFSWTSKALPPKESRSSTGDFFKDLNSHCPQEAVMQEQD
MSLLRGGPGVYKVVKTGPSGHNIRSCPNLRGIPIGMLVLGNKVKAVGEVTNSEGTWVQMD
KNSMVEFCESDEGEAWSLARDRGGNQYLRHEDEQVLLDQNVQTPPPSPFSIQAFSKGTSC
SNGQGFDYGLGNNKGDQLSAILNSIQSRPNLPAPSIFDQAAKPPSSLVHSPFVFGQPLSF
QQPQPQLQSDRVNFTGAARPISPAGKSDMSSKHRADSRSPKLDVRMNRAAADQKKPRNTD
GLSASESLLLKSDAAKLRSDSHSRSLSPNHNTLQTLKTDGRTTTGLRAESPGPGTRSSSP
KTKTLTAVRSGASSPRSSSPHDKMVPQKASSPVKTKLDPPRERSKSDSYTLDPDTLRKKK
VPLTESLRGRSTSPKPKIITKDVTPTETENRAPSPHVVQENLHSEVVEVCTSSTLKTNSI
TDSTCEDNTEFRSLDDSSNKVHFSIGKAPLKDEQDMRASPKVSRKCAGRHTRPKKEKSNF
LFKGDGSKSIEPAKQAMSPSVAECARAVFAAFLWHEGIVHDAMACSSFLKFNPELSKEHA
PIRSSLTQQPAEEKETKLKNRHSLEISSALNMFNIAPHGPDISKMGSINKNKVLSMLKEP
PLHEKCEDGKTETTSFETSSHHTMKSKSPLPLTLQHLVAFWEDISLATIKAASQNMIFPS
PGSCAVLKKKENDKDNKKTKKEKKKKEKVEARPRGNLFGEMAQLAVGGPEKDTICELCGE
SHPYPVTYHMRQAHPGCGRYAGGQGYNSIGHFCGGWAGNCGDGGIGGSTWYLVCDRCREK
YLREKQAAAREKIKQSRRKPMQVKTPRALPTMEAHQVIKANALYLLSLSSAAEPSILCYH
PVKAFQSQLPSLKEGISEDFPIKMPCLYLQTLARHHHENFAGYQDDNLFQDEMRYLRSTS
VPAPYISVTPDASPNVFEEPESNMKSMPPSLETSPITDTDLAKRTVFQRSYSVVASEYDK
QHSILPARVKAIPRRRVNSGDAEVGSSLLRHPSPELSRLISAHSSLSKGERNFQWPVLAF
VIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVASLTPAPV
EPEEEEDEENKSNKENAEQEKDTRVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMMS
LPSGSALQQMALRCWSLKFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFSISIQSGF
EVMNQELCIVVCLKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITINC
VKGINARYVCVHVDNSRDLGNKVTSMTFLTGKAVEDLCRIKQVDLDSRHIGWVTSELPGG
DNHIIKIELKGPENTLRVRQVKILGWKDGESIKIAGQISASVAQQRNCESETLRVFRLIT
SQVFGKLISGDAEPTPEQEEKALLSSPEGEEKVHNATSDADLKEHMVGIIFSRSKLTNLQ
KQVCAHIVQAIRMEATRVREEWEHAISSKENANSQPNDEDASSDAYCFELLSMVLALSGS
NVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPSRLASIIGVKALPPA
DISDIIHSTEKGDWNKLGILDMFLGCIAKALTVQLKAKGTTITGTAGTTAGKGVTTVTLP
MIFNSSYIRRGESHWWMKGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKNAIAETIIAL
TKMEEEYRSPVRCIATTRLWLALASLCVLDQDHVDRLSSGRWMGKDGQQKQMPMCDNHDD
GETAAIILCNACGNLCTDCDRFLHLHRRTKTHQRQVFKEEEEAIKVDLHEGCGRTKLFWL
MALADSKTMKAMVEFREQTGKPTTSSSEACRFCGCRSGTELSAVGSVCSDTDCQEYAKIA
CSKTHPCGHPCGGVKNEEHCLPCLHGCDKNATTLKQDADDMCMICFTEALSAAPAIQLDC
SHVFHLQCCQRVLENRWLGPRITFGFMSCPICKNKINHTVLKDLLDPIKELYEDVRRKAL
MRLEYEGLHKSEAITTPGVRFYNDPAGYAMNRYAYYVCYKCKKNETRKED
Download sequence
Identical sequences ENSGALP00000027295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]