SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000027459 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000027459
Domain Number 1 Region: 340-390
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000027459   Gene: ENSGALG00000017027   Transcript: ENSGALT00000027511
Sequence length 849
Comment pep:known_by_projection chromosome:Galgal4:1:169746469:169766315:1 gene:ENSGALG00000017027 transcript:ENSGALT00000027511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQMLKDFSNLLLVVLCDYVLGEVEDLLLKRPGHVAFSKDTVSVEYHYYSGNETAENLSI
LLLDANTNKIIARKQLPVNQSRGMVEFECFYFTSAGDFLFRMISPSDNSSAAASGRRTST
LHVEWPVFHIDLNKTSEVLGSSLQVGVFTNEQLCAMNETVVSLDVIFTSTLYELGRVSSD
EMLGIRTSKGIPLSRSQWVEFDCPHVGQEMYITVLLKSLETHSVIASMGPIDLHKFGYRL
VVAPEAVCRTLVQVFIVSPPCTSISGKVVVYKEALKHPSLRTTWLYENTLHPGDNRTEFN
CTLFDVGKNKYCFDLYNFSNRSHFPTRVKQCMMIQRNMETWSPWQPWSPCSVTCGDGIRE
RFRECFTSSPVKPGCAGSPKETSLCSLEECLTVKAPTPPSVQPGEDQKANNIVTITGISL
CLFIIFATVLITLWRKLCRAQKCSTAMRRNSIHSPGFRKNSDEENICQGNKQRDSFTEGG
DAPVNIPLTYRRSLQFAQEDDASGSESFQPNAQKIIPPIFSYRLAQQQLKEMKKKGLTET
TKVYHVSQNPLTDTVVGATTMLPLSAETQEEGAANKFRIKSPFLDQAAGQPKFVGEGCNP
RLDFPFSQASAAMSSTQTLIRRAHFKHPDNRGELCERGCHRNPQFRRTASFHETKKARPF
RERSMSTLTPRQTPLYTSRTRTWDQGLEDRTRPKLRNTNPTSEKLDQPHGTAPTCEPQGH
GTKGHHRACPPVKKLDLIADRQHAGQERGPEKPEPSRSKRGPSPNPKGAWRKETGSAGKE
SHQRGLTVSPAQYRKDKCQSFPVDPEFAFYDNTSFGLTEAEQQMIDLPGYFGSNEEDERS
TLSMEKLMI
Download sequence
Identical sequences 9031.ENSGALP00000027459 ENSGALP00000027459 XP_015131464.1.86415 XP_015131467.1.86415 XP_015131471.1.86415 XP_417078.1.86415 ENSGALP00000027459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]